SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507520158|ref|YP_008041772.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507520158|ref|YP_008041772.1|
Domain Number 1 Region: 1-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.81e-119
Family AAT-like 0.00000000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507520158|ref|YP_008041772.1|
Sequence length 398
Comment aromatic amino acid aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MFEHVDAYAGDPILTLVETFHKDTREQKVNLGIGLYYDEQGRIPLLASVQQAEAQRAAAP
APRPYQPMEGAANYRTAVQHLLFGADHEAVKAGRIATIQTIGGSGALKIGADLLKRYFPT
SEVWVSNPTWDNHKAMFEGAGIKVHDYPYYDAATGGVQFDAMIDCLSSLPTKSIVLLHPC
CHNPTGVDLSRAQWDQVIALVVEKNLIPFMDIAYQGFGDGLEEDAYAIRAMVAAGVSFFV
SNSFSKNLSFYGERCGGLSVICQDAEEASRVLGQMKATVRRNYSSPPTHGGQITAAVMND
ASLHTLWVGEVTEMRTRIKAMREKLFEVLSAKVPGRDFSYFTNQRGMFSYTGFTPEQVDR
LREEFAVYLVRSGRMCVAGLNSRNVDYVADAMAAVLKG
Download sequence
Identical sequences A0A1U6Y4C1
gi|507520158|ref|YP_008041772.1| WP_016349383.1.11585 WP_016349383.1.17591 WP_016349383.1.17828 WP_016349383.1.1904 WP_016349383.1.2747 WP_016349383.1.34398 WP_016349383.1.4153 WP_016349383.1.51862 WP_016349383.1.5367 WP_016349383.1.56245 WP_016349383.1.62064 WP_016349383.1.62601 WP_016349383.1.62729 WP_016349383.1.6571 WP_016349383.1.9133 WP_016349383.1.93440 WP_016349383.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]