SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507520577|ref|YP_008042191.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507520577|ref|YP_008042191.1|
Domain Number 1 Region: 4-377
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.09e-112
Family GABA-aminotransferase-like 0.00000000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507520577|ref|YP_008042191.1|
Sequence length 378
Comment UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MQDFLPFSRPAIGDAEISAVCDVLKSGWITTGPKNHELEQQFCDTFGCQHAVALCSATAG
MHVTLLALGIGPGDEVITPSQTWVSTINIITLLGAEPVFVDVDPDTLMTSAELIAPLITA
RTKAIIPVHYAGAPVDLDPILALAGQHGIPVIEDAAHAVGTRYRERWIGASGTAIFSFHA
IKNLTCAEGGMLVTDDKALADKVRMLKFHGLGVDAFDRMSLGRKPQAEVITPGFKYNLAD
INAAIALVQLARLPELNAKRAELVARYQERLTGLPLAPLAVPGYPHLHAWHLFMVRVDPD
RCGLDRDQLMQALQERGIGTGLHFRAAHTQKYYRERYPTLSLPHTEWNSSRLCTLPLFPD
MTLADVDRVVAALIDILE
Download sequence
Identical sequences A0A1U6Y3C4
WP_016349715.1.11585 WP_016349715.1.17591 WP_016349715.1.17828 WP_016349715.1.1904 WP_016349715.1.2747 WP_016349715.1.34398 WP_016349715.1.34829 WP_016349715.1.4153 WP_016349715.1.51862 WP_016349715.1.5367 WP_016349715.1.56245 WP_016349715.1.62064 WP_016349715.1.62601 WP_016349715.1.62729 WP_016349715.1.6571 WP_016349715.1.9133 WP_016349715.1.93440 WP_016349715.1.94363 gi|507520577|ref|YP_008042191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]