SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507520786|ref|YP_008042400.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507520786|ref|YP_008042400.1|
Domain Number 1 Region: 130-562
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.49e-106
Family Ornithine decarboxylase major domain 0.000000472
Further Details:      
 
Domain Number 2 Region: 567-708
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 1.29e-41
Family Ornithine decarboxylase C-terminal domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507520786|ref|YP_008042400.1|
Sequence length 710
Comment lysine decarboxylase CadA [Aeromonas hydrophila ML09-119]
Sequence
MNIIAILNHLGVFFKEEPIRQLQASLERKGFEVVYPVDVADLLKLIEKNPRVCGAIFDWD
KYSLGLCKEIHDRNEKLPIFAFANDQSTLDIHLTDLRLNVHFFEYRLGMADDIALKMGQA
TQEYQDAILPPFTKALFKYVEEGKYTFCTPGHMGGTAFQMSPAGSIFYDFYGPNAFKADV
SISMPELGSLLDHSGPHKEAEEYIARTFNADRSYIVTNGTSTANKIVGMYSAPAGSTVLV
DRNCHKSLTHLMMMNDVTPLYFRPTRNAYGILGGIPQSEFSRETIKAKVAATPGAQAPRY
AVITNSTYDGLLYNTGFIKEALDTPYIHFDSAWVPYTNFSPIYEGKCGMSGEAMPGKVFY
ETQSTHKLLAAFSQASMIHIKGDVEEETFNEAFMMHTSTSPQYGIVASTEISAAMMRGNT
GKRLIKDSIDRAISFRKEIKRLREQSEGWFFDVWQPDDIDTVECWKLDPKDDWHGFKDID
DNHMYLDPIKVTLLTPGMGRNGQLLENGIPASLVSKFLDERGIVVEKTGPYNLLFLFSIG
IDQSKAMQLLRALTEFKRGYDLNLTIKSILPSLYREDPSFYEGMRIQELAQRIHELTSKY
RLPELMFKAFDVLPEMKMTPHAAWQQELAGNVVEVPLRDMVDRISANMILPYPPGVPLVL
PGEMVTQDSLPVLEFLEMLCEIGAHYPGFETDIHGLYRQADGSYTVKVLR
Download sequence
Identical sequences A0A1U6Y356
gi|507520786|ref|YP_008042400.1| WP_016349881.1.11585 WP_016349881.1.17591 WP_016349881.1.17828 WP_016349881.1.1904 WP_016349881.1.2747 WP_016349881.1.34398 WP_016349881.1.4153 WP_016349881.1.44246 WP_016349881.1.48639 WP_016349881.1.51862 WP_016349881.1.5367 WP_016349881.1.56245 WP_016349881.1.62064 WP_016349881.1.62601 WP_016349881.1.62729 WP_016349881.1.6571 WP_016349881.1.77035 WP_016349881.1.9133 WP_016349881.1.93440 WP_016349881.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]