SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521169|ref|YP_008042783.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521169|ref|YP_008042783.1|
Domain Number 1 Region: 4-419
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.42e-128
Family GABA-aminotransferase-like 0.000000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507521169|ref|YP_008042783.1|
Sequence length 424
Comment adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MTNQEFDLHHVWHPYTSLTHPLPCYEVASARGVTLTLSDGRELVDGMSSWWACVHGYQVP
ELDAAATAQLGKMSHVMFGGLTHAPAVDLCRKLVEITPAGLDRVFLADSGSVAVEVALKM
AQQYWHAKGTPRAKFVALRGGYHGDTFGAMSVCDPDGGMHELYKGFLPEHHFVEAPSCRF
HAEWDEQCVVELATLVADHHEEIAAIVLEPIVQGAGGMRFYHPRYLQWVRALCDEFGLLL
IADEIATGFGRTGQLFACDWAGISPDIMCLGKALTGGYLTLSATLTTEHVARTVCDGKAG
VFMHGPTFMGNPLACAVANASIDLLLASPWQERVRAIEHQLKTELVELTLHPAVADVRVL
GAIGVVEMKERVDVARIQRKFVELGAWIRPFGKLVYLMPPFVISPAQLTVLTNAITAAIH
SGEY
Download sequence
Identical sequences A0A1U6Y1R1
gi|507521169|ref|YP_008042783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]