SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521317|ref|YP_008042931.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521317|ref|YP_008042931.1|
Domain Number 1 Region: 93-465
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.45e-90
Family AAT-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-19
Family GntR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507521317|ref|YP_008042931.1|
Sequence length 479
Comment GntR family transcriptional regulator [Aeromonas hydrophila ML09-119]
Sequence
MSLYGQLADQLQQQITSGLWQPGERIPSIRQSCKTHGLSPMTVLQAYQLLESRGLILARP
QSGYYVKAAPSRPTASLPQQAHYSGSVDINDLVFEVLQASKSRELVPLGMAVADPTLFPH
PQLGRALASSMRRLDPFSTVADLPPGNEALRRAIAQRYAGEGLAVDPQQIIITTGAMEAL
SLSLQVLTEPGDWVVVESPTFYGALQAIERLKLNAVEIPVIPGVGIDLALLEEALAQRPI
KACWLMGNVQHPLGHTMPDDHKQALMALLNRRGVALVEDDVYAEVYFGRERPRPIKYWDT
SGDSLLCSSFSKCLAPGFRVGWVVAGRHAERVQRLQLMSTLSTNVPSQLALAEMLRQGGV
DAHFRRLRHSLAQRQQQMRAALLRLLPGEVSISSPDGGYFLWLEFDPRLDSRALHAQALA
SGFSLAPGALFSSKGLHNHCLRLNSSHPWSPQLEAALVRLAELIHRQLGAVPAKNNKAP
Download sequence
Identical sequences A0A1U6Y1Q6
gi|507521317|ref|YP_008042931.1| WP_016350294.1.11585 WP_016350294.1.17591 WP_016350294.1.17828 WP_016350294.1.1904 WP_016350294.1.2747 WP_016350294.1.34398 WP_016350294.1.4153 WP_016350294.1.51862 WP_016350294.1.5367 WP_016350294.1.56245 WP_016350294.1.62064 WP_016350294.1.62601 WP_016350294.1.62729 WP_016350294.1.6571 WP_016350294.1.9133 WP_016350294.1.93440 WP_016350294.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]