SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521399|ref|YP_008043013.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521399|ref|YP_008043013.1|
Domain Number 1 Region: 28-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.41e-92
Family GABA-aminotransferase-like 0.00000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507521399|ref|YP_008043013.1|
Sequence length 429
Comment class III aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MTSRYQHSLALSARAEQSIPLGSQTFSKSRLCFPYGAAPLFIERGKGAQVWDVDGNEYLD
FASGLLAISLGYCDPDVNDAVMEQLNLGSIFSLPHRLETEVAEQLIELIPCAEMVRFGKN
GTDATSACIRLSRAVTGRERVAVCGYHGWQDWYIGSTTRHLGVPECVRELTHRFDYNDLA
SLQRLLEAHPGEFAAVILEPMNVTWPTPDFLPGLRQLCDAHGALLIFDETITGFRYHLGG
AQSLFGVTPDLAAFGKGMANGFPISAVVGRRQYMKRMEDIFFSGTFGGDVIALAAANAVI
KKMRRLDVPKRLAERGQQVLDGLDNLLKQIDAPDWLQTAGHPSWSFLLVADSANHSTWLL
KSYLIQELCKRGILTLGSHNMNLAHSEQDVAVLLAAYRDILPVLIRHDRDLTLASALDGE
PIQPVFRVR
Download sequence
Identical sequences A0A1U6Y147
WP_016350361.1.11585 WP_016350361.1.17591 WP_016350361.1.17828 WP_016350361.1.1904 WP_016350361.1.2747 WP_016350361.1.34398 WP_016350361.1.4153 WP_016350361.1.51862 WP_016350361.1.5367 WP_016350361.1.56245 WP_016350361.1.62064 WP_016350361.1.62601 WP_016350361.1.62729 WP_016350361.1.6571 WP_016350361.1.9133 WP_016350361.1.93440 WP_016350361.1.94363 gi|507521399|ref|YP_008043013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]