SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521402|ref|YP_008043016.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521402|ref|YP_008043016.1|
Domain Number 1 Region: 2-378
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.6e-108
Family GABA-aminotransferase-like 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507521402|ref|YP_008043016.1|
Sequence length 380
Comment polysaccharide biosynthesis protein [Aeromonas hydrophila ML09-119]
Sequence
MIPYGRQSISDADIEAVVAVLKSDYLTQGQAVPAFEQGLANYCQVPHVVACSNGTTALHL
ACAVLELGAKDTVWVSAVSFVASANCVRYCDANVDFVDVEPATGNLDVVALNKKLQKAVL
THTLPKALIAVHLAGQPCDLEEIGVLCRQYGIILIEDACHALGAHYQGSPIGSCLHSDMT
VFSFHPVKPITTAEGGAVTTRDQQLAAKLRLYRSHGITRDPQALLMPSPGEWYYEQQLLG
FNYRLTDIQAALGLSQLSRLDQFIAQRCELARRYDELLSPLPVQPLQQSNNRQSGYHLYV
IQVAERDQVFARMRAAGIGVNVHYIPIPAQPYYRGLGHNPAAYPGAQAYYQRAISLPLFP
ALTHSEQQQVVDALEQALCG
Download sequence
Identical sequences A0A1U6Y158
gi|507521402|ref|YP_008043016.1| WP_016350364.1.11585 WP_016350364.1.17591 WP_016350364.1.17828 WP_016350364.1.1904 WP_016350364.1.2747 WP_016350364.1.34398 WP_016350364.1.4153 WP_016350364.1.51862 WP_016350364.1.5367 WP_016350364.1.56245 WP_016350364.1.62064 WP_016350364.1.62601 WP_016350364.1.62729 WP_016350364.1.6571 WP_016350364.1.9133 WP_016350364.1.93440 WP_016350364.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]