SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521444|ref|YP_008043058.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521444|ref|YP_008043058.1|
Domain Number 1 Region: 5-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.31e-114
Family Cystathionine synthase-like 0.0000000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507521444|ref|YP_008043058.1|
Sequence length 404
Comment cysteine desulfurase [Aeromonas hydrophila ML09-119]
Sequence
MKLPIYLDYSATCPVDPRVAEKMMQCLTMDGLFGNPASRSHRFGWQAEEAVDLARNQVAE
LIGADPREIVFTSGATESNNLAIKGVAHFYAGKGKHIVTSKTEHKAVLDTCRQLEREGYE
VTYLEPMPNGLFTLEQIEGALRDDTILVSIMHVNNEIGVVQNIAAIGELCRSRKILLHVD
AVQSVGKIPVDVEALKVDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGMR
SGTLPTHQIVGMGEAFRIAKEEMVSEGQRIMALRQRLWDGIKDIEEVYINGDLEQRVPGN
LNVSFAYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSMGRF
TTEEEIDYAIKLIRDSIGRLREMSPLWEMYKDGVDLNTVEWAHH
Download sequence
Identical sequences A0A0A6XDT7 A0A1N6QG45 A0A1U6Y118 K1JSM6
WP_005299763.1.100377 WP_005299763.1.11394 WP_005299763.1.11585 WP_005299763.1.12326 WP_005299763.1.13401 WP_005299763.1.16146 WP_005299763.1.17591 WP_005299763.1.17828 WP_005299763.1.1904 WP_005299763.1.21213 WP_005299763.1.2747 WP_005299763.1.34034 WP_005299763.1.34398 WP_005299763.1.34829 WP_005299763.1.38175 WP_005299763.1.4153 WP_005299763.1.43483 WP_005299763.1.45454 WP_005299763.1.48145 WP_005299763.1.48811 WP_005299763.1.51574 WP_005299763.1.51862 WP_005299763.1.5367 WP_005299763.1.56245 WP_005299763.1.56470 WP_005299763.1.60150 WP_005299763.1.61841 WP_005299763.1.62064 WP_005299763.1.62121 WP_005299763.1.62601 WP_005299763.1.62729 WP_005299763.1.65522 WP_005299763.1.6571 WP_005299763.1.66799 WP_005299763.1.69299 WP_005299763.1.81915 WP_005299763.1.85013 WP_005299763.1.9133 WP_005299763.1.93440 WP_005299763.1.94363 WP_005299763.1.95182 WP_005299763.1.97559 WP_005299763.1.99242 gi|507521444|ref|YP_008043058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]