SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521489|ref|YP_008043103.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521489|ref|YP_008043103.1|
Domain Number 1 Region: 3-336
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.18e-115
Family AAT-like 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507521489|ref|YP_008043103.1|
Sequence length 339
Comment L-allo-threonine aldolase [Aeromonas hydrophila ML09-119]
Sequence
MRYIDLRSDTVTQPTDAMRQSMLHAEVGDDVYGEDPGVNALEARGAELLGKEAALFVPSG
TMSNLLAVMSHCQRGEGAIVGQAAHIYRYEAQGSAVLGSVALQAVPMQADGSLAVADVAA
AIAPDDAHFVQTRLVCLENTHNGKVLPLHYLQTMRKFVDERGLQLHLDGARLFNAAVASG
HGVHELAAPFDSISICLSKGLGAPVGSLLVGSRVFIARARRLRKMLGGGMRQAGILAQAG
LFALDQHVARLADDHRRARQLAEGLAALPGIELDLALVQTNMVFLRLAKGDAEALLAFMK
ERGILFSGYGEMRLVTHLQITDDDIDEVIDAFTEYLAVR
Download sequence
Identical sequences A0A1U6Y0X2
WP_016350428.1.11585 WP_016350428.1.17591 WP_016350428.1.17828 WP_016350428.1.1904 WP_016350428.1.2747 WP_016350428.1.34398 WP_016350428.1.4153 WP_016350428.1.51862 WP_016350428.1.5367 WP_016350428.1.56245 WP_016350428.1.62064 WP_016350428.1.62601 WP_016350428.1.62729 WP_016350428.1.6571 WP_016350428.1.9133 WP_016350428.1.93440 WP_016350428.1.94363 gi|507521489|ref|YP_008043103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]