SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521610|ref|YP_008043224.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521610|ref|YP_008043224.1|
Domain Number 1 Region: 68-462
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.07e-103
Family GABA-aminotransferase-like 0.00000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507521610|ref|YP_008043224.1|
Sequence length 474
Comment 4-aminobutyrate aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MTSLLALGRDLHDEKLHGSGRADSEGDINLGEGRSRWWAGQSEAVQAGLAEDSRYFLHQA
LSTPCLDLLERAQGSWLTSVSGKRYLDFHGNSVHQLGHGHPRVVAAVQQQLADLPFAPRR
YTHQVAIDCARTLAELAPGDLNRVLFAPGGSEVVGIALKLARFITGNSKVVSLWDAFHGA
SLDAISVGGEACFRAGMGPLMAGVERIPPPTRYRGVWYRGEGDDLHYADYLEYVIEKEGG
IGAFIAEPIRNTDVQVPSKAYWQRVREICDRHKVLLIVDEIPNALGRTGHWFSFEEFGIE
PDIICLGKGLGGGVVPFEALITRDRFNQAAAISLGHYTHEKSPIGCAAALATIATIREAG
LLAKAQEDGRFMACELGKLAERHPLIGQVRGIGLLWALDLVVDHQSRTRNSQAAERLLYR
CLELGLSFKVSQGNVIQLSPPLNIARADLVRAITILDRALGEIALSPKQEYHHD
Download sequence
Identical sequences A0A1U6Y0H9
gi|507521610|ref|YP_008043224.1| WP_016350515.1.11585 WP_016350515.1.17591 WP_016350515.1.17828 WP_016350515.1.1904 WP_016350515.1.2747 WP_016350515.1.34398 WP_016350515.1.4153 WP_016350515.1.51862 WP_016350515.1.5367 WP_016350515.1.56245 WP_016350515.1.62064 WP_016350515.1.62601 WP_016350515.1.62729 WP_016350515.1.6571 WP_016350515.1.9133 WP_016350515.1.93440 WP_016350515.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]