SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507521635|ref|YP_008043249.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507521635|ref|YP_008043249.1|
Domain Number 1 Region: 2-461
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.46e-138
Family Beta-eliminating lyases 0.0000000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507521635|ref|YP_008043249.1|
Sequence length 461
Comment tryptophanase/L-cysteine desulfhydrase, PLP-dependent [Aeromonas hydrophila ML09-119]
Sequence
MRRIPEPFRIKMVEPIKQTTGAERRAALEAAGWNPFLLLAEDVYIDLLTDSGTGAMSDRQ
WAGIMMGDEAYAGSRNFVELERAVRDIFGYQHVMPTHQGRGAEQILFPELVKRCQGKAPV
FISNYHFDTTKAHVELAGARAINLLTPKALDTTAPYAWKGDFDLPRLTDTIETLGADNVA
GIIITVTCNSAGGQPVSMANMEAVAELARRHHIPVVIDAARFAENAWFIKERDPAYAKRS
IKEIVRQMFALGDIFTMSAKKDGLVNIGGLCCFKEDLDLFRTVQVRCVAMEGFVTYGGLA
GRDMAALAIGLREGMDEEYLTYRISQVAYLGERLAEAGIPIQTPTGGHAVFVDAKKLLPH
IPAEQFPAHALACELYLEGGVRGVEIGSLLLGRDPATGKQEAADFELLRLTIPRRVYTRD
HMDYVADCLIAVKARASDIHGLTFDYEPPLLRHFTARLKPV
Download sequence
Identical sequences A0A1U6Y0E0
gi|507521635|ref|YP_008043249.1| WP_016350537.1.11585 WP_016350537.1.17591 WP_016350537.1.17828 WP_016350537.1.1904 WP_016350537.1.2747 WP_016350537.1.34398 WP_016350537.1.4153 WP_016350537.1.51862 WP_016350537.1.5367 WP_016350537.1.56245 WP_016350537.1.62064 WP_016350537.1.62601 WP_016350537.1.62729 WP_016350537.1.6571 WP_016350537.1.9133 WP_016350537.1.93440 WP_016350537.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]