SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507522116|ref|YP_008043730.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507522116|ref|YP_008043730.1|
Domain Number 1 Region: 3-360
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.2e-111
Family GABA-aminotransferase-like 0.00000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507522116|ref|YP_008043730.1|
Sequence length 362
Comment 3-phosphoserine/phosphohydroxythreonine aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MSKQIYNFCAGPAMLPVEVMERAQREFCNFQGLGASVMELSHRGKPYMAVAAKAEADLRE
LLAVPDNYKVLFMHGGGRGQFSAVPMNLLGGANKKADYLLTGVWAASAVDEARKYGDIQT
FDGVAKSAEGISHLLPTPAFRADAAYVHYCPNETIDGIEMFDIPATGDVPLVADLSSTIL
SRPIDVSRFGIIYAGAQKNIGPSGLAIAIVRDDLLNQARADVPSIFDYQLTAKNDSMFNT
PPTYAWYLAGLVFEWLKEQGGLEAMEARNKEKADFLYGYLDQSSFYGNQVDASCRSRMNI
PFQLKNAELDKLFLAESEAAGLLALKGHRIVGGMRASLYNAMPLEGVKALVSFMDGFAKR
HG
Download sequence
Identical sequences A0A1U6XZ13 A0A1V2F1N8
gi|507522116|ref|YP_008043730.1| WP_016350946.1.11585 WP_016350946.1.17591 WP_016350946.1.17828 WP_016350946.1.1904 WP_016350946.1.2747 WP_016350946.1.34398 WP_016350946.1.4153 WP_016350946.1.51862 WP_016350946.1.5367 WP_016350946.1.56245 WP_016350946.1.60150 WP_016350946.1.62064 WP_016350946.1.62601 WP_016350946.1.62729 WP_016350946.1.6571 WP_016350946.1.69299 WP_016350946.1.85013 WP_016350946.1.9133 WP_016350946.1.93440 WP_016350946.1.93930 WP_016350946.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]