SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507522292|ref|YP_008043906.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507522292|ref|YP_008043906.1|
Domain Number 1 Region: 5-400
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.63e-97
Family AAT-like 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507522292|ref|YP_008043906.1|
Sequence length 404
Comment aminotransferase AlaT [Aeromonas hydrophila ML09-119]
Sequence
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
Download sequence
Identical sequences A0A081USC2 A0A1U6XYL9 A0A2H9U3J4 A0KLI5
WP_011706443.1.100377 WP_011706443.1.11585 WP_011706443.1.12787 WP_011706443.1.13401 WP_011706443.1.17591 WP_011706443.1.17828 WP_011706443.1.1904 WP_011706443.1.2747 WP_011706443.1.28436 WP_011706443.1.34034 WP_011706443.1.34398 WP_011706443.1.34829 WP_011706443.1.38175 WP_011706443.1.4153 WP_011706443.1.41987 WP_011706443.1.44246 WP_011706443.1.48639 WP_011706443.1.51862 WP_011706443.1.52677 WP_011706443.1.5367 WP_011706443.1.56245 WP_011706443.1.56470 WP_011706443.1.60150 WP_011706443.1.62064 WP_011706443.1.62309 WP_011706443.1.62601 WP_011706443.1.62729 WP_011706443.1.64954 WP_011706443.1.6571 WP_011706443.1.66799 WP_011706443.1.67280 WP_011706443.1.77035 WP_011706443.1.9133 WP_011706443.1.93440 WP_011706443.1.93930 WP_011706443.1.94363 WP_011706443.1.95182 YP_857136.1.44769 gi|117621027|ref|YP_857136.1| 380703.AHA_2627 gi|507522292|ref|YP_008043906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]