SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507522504|ref|YP_008044118.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507522504|ref|YP_008044118.1|
Domain Number 1 Region: 1-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.64e-113
Family AAT-like 0.000000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507522504|ref|YP_008044118.1|
Sequence length 396
Comment aromatic amino acid aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MFEKVVAAPADPILGLTEAFRADSRSHKINLGVGIYKDETGATPILHCVKKAEQKLLTDE
KTKNYLGIEGNIEYGRIVQRLLFGQDSALVASGRAKTAQAPGGTGALRIAAEFVVRNGLA
KTVWISDPTWANHVSVFQAAGLTVKWYKYYDAASKGLDFAAMQASLAEVQAGDLVLLHGC
CHNPTGIDPTAEQWRALAKQSAAAGWLPLFDFAYQGFARGIEEDAEGLRIFAECHDELLV
ASSFSKNFGLYNERVGAFTLVSATKEIADVAFTQVKTVIRANYSNPPSHGAAVVTAVVSD
PALYAEWVEEVAAMRVRIREMRELLVEKLAARGVNQDFSFIREQNGMFSFSGLSKDQVER
LKSEFAIYIVGSGRISVAGITRANIDPLCDAIAKVL
Download sequence
Identical sequences A0A1U6XY00
WP_016351283.1.11585 WP_016351283.1.17591 WP_016351283.1.17828 WP_016351283.1.1904 WP_016351283.1.2747 WP_016351283.1.34398 WP_016351283.1.4153 WP_016351283.1.51862 WP_016351283.1.5367 WP_016351283.1.56245 WP_016351283.1.62064 WP_016351283.1.62601 WP_016351283.1.62729 WP_016351283.1.6571 WP_016351283.1.9133 WP_016351283.1.93440 WP_016351283.1.94363 gi|507522504|ref|YP_008044118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]