SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507522616|ref|YP_008044230.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507522616|ref|YP_008044230.1|
Domain Number 1 Region: 12-365
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.08e-104
Family GABA-aminotransferase-like 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507522616|ref|YP_008044230.1|
Sequence length 367
Comment glutamine--scyllo-inositol transaminase [Aeromonas hydrophila ML09-119]
Sequence
MINFLDLSAINKQYKQELKDACARVIDSGWYIMGDELRKFESEFSAYCGTKHAIGVANGL
DALILVLRAWKELGKLKAGDEVIVQANTYIASVLAITENDLVPVLVEPNMHTYNLDPELV
RAAITPKTKVLLPVHLYGQLSPMPELMAIAKEHELLVLEDCAQSHGAEINGKRAGNWGDA
AGFSFYPGKNLGALGDAGAVTTNDDELAQTIRALRNYGSHKKYENLYQGVNSRLDEIQAA
MMRVKLPYLEGETARRQSIAQSYRASINNPLVTMPCVDNESAHVWHLFVLRCDIRDQLQQ
WLSKQDIQTLIHYPIPPHKQKAYPAFQNYQLPLTELIHQQVLSLPMDPTMSDEAVTKVIN
AVNGFTA
Download sequence
Identical sequences X5CCC5
gi|507522616|ref|YP_008044230.1| WP_016351366.1.11585 WP_016351366.1.17591 WP_016351366.1.17828 WP_016351366.1.1904 WP_016351366.1.34398 WP_016351366.1.4153 WP_016351366.1.51862 WP_016351366.1.5367 WP_016351366.1.62601 WP_016351366.1.62729 WP_016351366.1.6571 WP_016351366.1.9133 WP_016351366.1.93440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]