SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507522739|ref|YP_008044353.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507522739|ref|YP_008044353.1|
Domain Number 1 Region: 25-424
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.72e-136
Family GABA-aminotransferase-like 0.00000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507522739|ref|YP_008044353.1|
Sequence length 429
Comment 4-aminobutyrate aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MSQSASNKAWQARREAAVVNGVGTLLPVFIERAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVRAQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPSDYLG
VSEADALAALDLCFSSDIEPTRVAAIIIEPVQGEGGFYPASASFMQRLRSICDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEVMNAAKPGGLGGT
YAGSPIACAAALAVLEVIEEEQLNQRAQAQGEQIKARLQQLAERFDCIGDIRGPGAMVAM
ELVKQRDAASPDADLTKRLVAEAGKRGLVLLACGVRANVIRFLAPLTASPALVDEGLDLL
EQALLAAQG
Download sequence
Identical sequences A0A1U6XXH6
gi|507522739|ref|YP_008044353.1| WP_016351479.1.11585 WP_016351479.1.17591 WP_016351479.1.17828 WP_016351479.1.1904 WP_016351479.1.2747 WP_016351479.1.34398 WP_016351479.1.4153 WP_016351479.1.51862 WP_016351479.1.5367 WP_016351479.1.56245 WP_016351479.1.62064 WP_016351479.1.62601 WP_016351479.1.62729 WP_016351479.1.6571 WP_016351479.1.9133 WP_016351479.1.93440 WP_016351479.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]