SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507523064|ref|YP_008044678.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507523064|ref|YP_008044678.1|
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-184
Family GABA-aminotransferase-like 0.00000000000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507523064|ref|YP_008044678.1|
Sequence length 417
Comment serine hydroxymethyltransferase [Aeromonas hydrophila ML09-119]
Sequence
MLKRDMTIAGYDPELWQAITDETRRQEEHIELIASENYTSPRVMEAQGSQLTNKYAEGYP
SKRYYGGCEYVDVVETLAIERAKELFGATYANVQPHSGSQANSAVYMALLQPGDTVLGMN
LAHGGHLTHGSPVNFSGKLYNIIPYGIDESGKIDYDDMERQAVEHKPKMMIGGFSAYSGI
VDWARMREIADKVGAWLFVDMAHVAGLIAAGVYPNPVPHAHVVTSTTHKTLAGPRGGLIL
SAADDEELYKKLNSAVFPGGQGGPLMHVIAGKAVAFKEALEPEFKTYQAQVVKNAKAMAA
TFIERGYKIVSGGTDNHLMLVDLIGRELTGKEADAALGKANITVNKNSVPNDPRSPFVTS
GVRIGTPAITRRGFKEAESIQLTNWICDVLDNHDNDAVLATVREQVLDICRRFPVYA
Download sequence
Identical sequences A0A081UMK4 A0A1U6XWZ6 A0KNH4
380703.AHA_3336 WP_011707102.1.100377 WP_011707102.1.11585 WP_011707102.1.12787 WP_011707102.1.17591 WP_011707102.1.17828 WP_011707102.1.1904 WP_011707102.1.2747 WP_011707102.1.28436 WP_011707102.1.34034 WP_011707102.1.34398 WP_011707102.1.34829 WP_011707102.1.4153 WP_011707102.1.41987 WP_011707102.1.44246 WP_011707102.1.48639 WP_011707102.1.48811 WP_011707102.1.51862 WP_011707102.1.52677 WP_011707102.1.5367 WP_011707102.1.56245 WP_011707102.1.56470 WP_011707102.1.60185 WP_011707102.1.61841 WP_011707102.1.62064 WP_011707102.1.62121 WP_011707102.1.62309 WP_011707102.1.62601 WP_011707102.1.62729 WP_011707102.1.64737 WP_011707102.1.64954 WP_011707102.1.65522 WP_011707102.1.6571 WP_011707102.1.67280 WP_011707102.1.69299 WP_011707102.1.77035 WP_011707102.1.81915 WP_011707102.1.9133 WP_011707102.1.93440 WP_011707102.1.93930 WP_011707102.1.94363 WP_011707102.1.95182 WP_011707102.1.97559 YP_857825.1.44769 gi|507523064|ref|YP_008044678.1| gi|117618195|ref|YP_857825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]