SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507523195|ref|YP_008044809.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507523195|ref|YP_008044809.1|
Domain Number 1 Region: 2-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.57e-105
Family AAT-like 0.000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507523195|ref|YP_008044809.1|
Sequence length 393
Comment aminotransferase, classes I and II [Aeromonas hydrophila ML09-119]
Sequence
MQPFFAQRFEKVEPSFIREILKVAANPEIISFAGGLPNPHLFPVKAIDQACQDVLREQGA
AALQYAATEGFAPLRQYIADRYLARHGMQVNPDNILITSGSQQALDLLGKVLIDEGQDLI
IEEPGYLGAIQAFSVYQPVFKPITLGEEGLDLAALDALLASGSNAKLLYGVPNFQNPSGV
SYSRANREALAERLVSHELLMVEDDPYGELRFEGEHLPPIAKLAPNNTVLLGSFSKTVVP
AFRLGWMLVPDWLRKKVTIAKQATDLHSNAFSQQVLHRFLIDNSLDAHLEKIKEVYGRQR
AAMKAALARHCPHGVSYTRPEGGMFLWLTLPSSVSAMALFDEAIKEKVAFVPGAPFYVRP
EIQNTLRLSFSCVDEATIEEGVKRLCRALARML
Download sequence
Identical sequences A0A1U6XW75
gi|507523195|ref|YP_008044809.1| WP_016351849.1.11585 WP_016351849.1.17591 WP_016351849.1.17828 WP_016351849.1.1904 WP_016351849.1.2747 WP_016351849.1.34398 WP_016351849.1.4153 WP_016351849.1.51862 WP_016351849.1.5367 WP_016351849.1.56245 WP_016351849.1.62064 WP_016351849.1.62601 WP_016351849.1.62729 WP_016351849.1.6571 WP_016351849.1.9133 WP_016351849.1.93440 WP_016351849.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]