SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507523226|ref|YP_008044840.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507523226|ref|YP_008044840.1|
Domain Number 1 Region: 2-425
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.22e-139
Family GABA-aminotransferase-like 0.000000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507523226|ref|YP_008044840.1|
Sequence length 428
Comment glutamate-1-semialdehyde aminotransferase [Aeromonas hydrophila ML09-119]
Sequence
MSKSDQLFEQARQTIPGGVNSPVRAFNGVGGTPRFIDHADGSYLYDVDGQAYVDYIGSWG
PMLLGHNHPAIRAAVIKAVEKGLSYGAPTEIEVLMAEKVRQIVPSMEQVRMVNSGTEATM
SAIRLARGYTGRDKIVKFEGCYHGHADSLLVKAGSGALTLGQPNSPGVPADFAKHTLTCV
FNDLDSVREAFSQYGSEIACIIVEPVAGNMNCIPPVPGFLEGLRAICDEAGTLLILDEVM
TGFRVSLRGAQGHYNIDPDLTTLGKIIGAGMPVGAFGGKKKVMQHIAPTGPVYQAGTLSG
NPVAMAAGLTMLDLLLEPGLYEQLSAKTARVAEGLKAAAAKHGIPLAINYVGGMFGFFFT
DEPEITRYEQVTRCNMERFKRFYHLMLEEGIYLAPSAYEAGFLSLAHGDKEIEHTLAAAE
RSFAKLAG
Download sequence
Identical sequences A0A1U6XW48
WP_016351872.1.11585 WP_016351872.1.17591 WP_016351872.1.17828 WP_016351872.1.1904 WP_016351872.1.2747 WP_016351872.1.34398 WP_016351872.1.4153 WP_016351872.1.51862 WP_016351872.1.5367 WP_016351872.1.56245 WP_016351872.1.62064 WP_016351872.1.62601 WP_016351872.1.62729 WP_016351872.1.6571 WP_016351872.1.9133 WP_016351872.1.93440 WP_016351872.1.94363 gi|507523226|ref|YP_008044840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]