SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507523299|ref|YP_008044913.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507523299|ref|YP_008044913.1|
Domain Number 1 Region: 83-449
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.65e-69
Family AAT-like 0.00021
Further Details:      
 
Domain Number 2 Region: 13-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.52e-16
Family GntR-like transcriptional regulators 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507523299|ref|YP_008044913.1|
Sequence length 458
Comment GntR family transcriptional regulator [Aeromonas hydrophila ML09-119]
Sequence
MTIWTPNLTPFAGPLYLKLVKAIEQAIQDGSLPPETRLPTHRALADRLGVTVGTVTRAYG
EAERRGLLAARVGHGTWVKGEHEDPANAWVIRKEEGHRIELWQNLPVQLDRAAIIRPMLA
EVADGDLNALLGYDKEAGQPSQRQLFIDWLAEQGVAGSEEYLLFSHGAQHGIMLSLLATG
CVGETLFCEGLSYPGMLGNARQLKNQVVGLAMDAEGLLPDALEAACRTRRAKLLYLTPTL
QNPTTATMSLARREAIVAIARRHNLLIIEDDVNGLLPQQPVTPLVNLAPERVIYLGSLAK
IACGGLRVGFVLTPPALRGAFAQAMRLSSWMVSPLLIELACKLVSQRQIMPLVEQQRQIL
ARRGELLRHLLPGACWQAGSMHAWLPLPEPWRSQEFAEAANALDVGVASGEHFAAGQFAA
PQGVRLSLSQPATDARVAEGLERLAGLLRAAPPTNTLL
Download sequence
Identical sequences A0A1U6XWB5
WP_016351933.1.11585 WP_016351933.1.17591 WP_016351933.1.17828 WP_016351933.1.1904 WP_016351933.1.2747 WP_016351933.1.34398 WP_016351933.1.4153 WP_016351933.1.51862 WP_016351933.1.5367 WP_016351933.1.56245 WP_016351933.1.62064 WP_016351933.1.62601 WP_016351933.1.62729 WP_016351933.1.6571 WP_016351933.1.9133 WP_016351933.1.93440 WP_016351933.1.94363 gi|507523299|ref|YP_008044913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]