SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507523640|ref|YP_008045254.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507523640|ref|YP_008045254.1|
Domain Number 1 Region: 7-368
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.05e-35
Family Cystathionine synthase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507523640|ref|YP_008045254.1|
Sequence length 371
Comment pyridoxal phosphate-dependent enzyme [Aeromonas hydrophila ML09-119]
Sequence
MPSVYEKYQLKPVINASGRMTILGVSTPEQEVVDAVNFGLGHYFEVKDLVNKTGAYLAGL
LDVEDAVVVSCASAGIAQSVAAVIVRGDPYRLEQLHAHAHNVPSEIVLPKGHNVNFGAPV
GTMVNLGGGKVVEAGYANECSATQLAAAINANTAAILYIKSHHCVQKSILSVAEAAEVAK
AHGLPLIVDAAAEEDLRLYYNQGADLVIYSGAKAIEGPTSGLVLGKRQYVEWVKQQANGI
GRAMKVGKEGILGLTHAIERYLAKEKESGAAMVAKMTPFIERLNQLPGVSAKVVWDSAGR
DIARTDIAFDHQQIGMTTVQVVARLQQGTPAIYCRGYKANEGHLEIDVRSVTVPQLDQIH
AAIAHLVQENN
Download sequence
Identical sequences A0A1U6XV37
gi|507523640|ref|YP_008045254.1| WP_016352195.1.11585 WP_016352195.1.17591 WP_016352195.1.17828 WP_016352195.1.1904 WP_016352195.1.2747 WP_016352195.1.34398 WP_016352195.1.4153 WP_016352195.1.51862 WP_016352195.1.5367 WP_016352195.1.56245 WP_016352195.1.62064 WP_016352195.1.62601 WP_016352195.1.62729 WP_016352195.1.6571 WP_016352195.1.9133 WP_016352195.1.93440 WP_016352195.1.94363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]