SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507523909|ref|YP_008045523.1| from Aeromonas hydrophila ML09-119

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507523909|ref|YP_008045523.1|
Domain Number 1 Region: 6-402
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.89e-125
Family Cystathionine synthase-like 0.00000000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507523909|ref|YP_008045523.1|
Sequence length 406
Comment cysteine desulfurase [Aeromonas hydrophila ML09-119]
Sequence
MNQQQHARLRSQFPALAQEVNGHPLIYLDNAATTQKPQVVLDAIAHYYSADNANVHRAAH
ALSGRATRAFEAARETVARFINAPHSREVIWTRGTTEAINLVAQSWGMSALQMGDEIVLS
TLEHHANIVPWQLIAQRTGAQIRVIPLDERGDLDLVAYHAMLGPRTRLVSVAHVSNALGT
VNPVARMVEAAKAVGAVTLIDGAQAVAHLEVDVQAIGCDFYAFSGHKLYGPTGIGVLWGR
TEQLERMPPWQAGGEMIDRVSFAGTTFNTLPFKFEAGTPHIAGAIGLAAAIDFVMEQDRD
SLASHEAALADYLVAGLQQVPGLRLVGEPGQRAGAVSFLLDEIHPQDAATLLNMQGIALR
VGHHCAMPLMESLGIGGTMRASLACYNNRDDVDALLAALHKLHDFF
Download sequence
Identical sequences A0A1U6XUA9
WP_016352381.1.11585 WP_016352381.1.17591 WP_016352381.1.17828 WP_016352381.1.1904 WP_016352381.1.2747 WP_016352381.1.34398 WP_016352381.1.4153 WP_016352381.1.51862 WP_016352381.1.5367 WP_016352381.1.56245 WP_016352381.1.62064 WP_016352381.1.62601 WP_016352381.1.62729 WP_016352381.1.6571 WP_016352381.1.9133 WP_016352381.1.93440 WP_016352381.1.94363 gi|507523909|ref|YP_008045523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]