SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384861199|ref|YP_005743919.1| from Staphylococcus aureus subsp. aureus str. JKD6008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384861199|ref|YP_005743919.1|
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.62e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000646
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.19e-27
Family Ribosomal protein L11, C-terminal domain 0.0000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384861199|ref|YP_005743919.1|
Sequence length 140
Comment 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus str. JKD6008]
Sequence
MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISV
YEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLNAAD
EEAAMRIIEGTARSMGIVVE
Download sequence
Identical sequences A0A077W4L0 A0A0D1JCM4 A0A0E1ADY6 A0A0E1VK23 A0A0E1XII8 A0A1E8X2X7 A0A2H5ALI5 A0A2K4AEK2 A0A2K4BHJ3 A5IQ91 A6TZ14 A7WYW0 A8YZN5 P0A0F1 P0A0F2 P0A0F3 P0A0F4 Q2FJA3 Q6GBV0 Q6GJD1 W8UT36
gi|537441956|ref|YP_008484533.1| gi|379795009|ref|YP_005325007.1| gi|15923527|ref|NP_371061.1| gi|15926215|ref|NP_373748.1| gi|49485402|ref|YP_042623.1| gi|404477925|ref|YP_006709355.1| gi|387779677|ref|YP_005754475.1| gi|88194299|ref|YP_499091.1| gi|385780803|ref|YP_005756974.1| gi|384868538|ref|YP_005748734.1| gi|156978866|ref|YP_001441125.1| gi|387149699|ref|YP_005741263.1| gi|514065496|ref|YP_008127416.1| gi|532358640|ref|YP_008448469.1| gi|384861199|ref|YP_005743919.1| gi|545636947|ref|YP_008587123.1| gi|379020308|ref|YP_005296970.1| gi|521211355|ref|YP_008167701.1| gi|148266997|ref|YP_001245940.1| gi|21282221|ref|NP_645309.1| gi|150393044|ref|YP_001315719.1| gi|387601891|ref|YP_005733412.1| gi|384546817|ref|YP_005736070.1| gi|161508777|ref|YP_001574436.1| gi|269202160|ref|YP_003281429.1| 158878.SAV0537 158879.SA0495 196620.MW0492 282458.SAR0542 282459.SAS0495 359786.SaurJH9_0560 359787.SaurJH1_0574 418127.SAHV_0535 451515.SAUSA300_0522 451516.USA300HOU_0531 681288.SAAV_0499 93061.SAOUHSC_00518 gi|479328540|ref|YP_007867599.1| WP_001085792.1.100013 WP_001085792.1.100028 WP_001085792.1.100041 WP_001085792.1.100049 WP_001085792.1.100057 WP_001085792.1.10006 WP_001085792.1.100067 WP_001085792.1.100072 WP_001085792.1.100084 WP_001085792.1.100088 WP_001085792.1.100094 WP_001085792.1.100117 WP_001085792.1.100122 WP_001085792.1.10014 WP_001085792.1.100154 WP_001085792.1.100171 WP_001085792.1.100180 WP_001085792.1.100184 WP_001085792.1.100189 WP_001085792.1.100235 WP_001085792.1.100265 WP_001085792.1.100272 WP_001085792.1.100298 WP_001085792.1.100307 WP_001085792.1.100310 WP_001085792.1.10032 WP_001085792.1.100335 WP_001085792.1.100347 WP_001085792.1.100352 WP_001085792.1.100366 WP_001085792.1.100384 WP_001085792.1.100391 WP_001085792.1.100399 WP_001085792.1.10041 WP_001085792.1.100452 WP_001085792.1.10046 WP_001085792.1.100464 WP_001085792.1.10050 WP_001085792.1.10053 WP_001085792.1.100534 WP_001085792.1.100535 WP_001085792.1.100551 WP_001085792.1.100561 WP_001085792.1.100562 WP_001085792.1.100582 WP_001085792.1.100596 WP_001085792.1.100618 WP_001085792.1.100631 WP_001085792.1.100647 WP_001085792.1.100665 WP_001085792.1.100668 WP_001085792.1.100678 WP_001085792.1.100693 WP_001085792.1.100699 WP_001085792.1.100704 WP_001085792.1.100719 WP_001085792.1.100726 WP_001085792.1.100761 WP_001085792.1.100768 WP_001085792.1.100823 WP_001085792.1.100832 WP_001085792.1.100834 WP_001085792.1.10085 WP_001085792.1.100860 WP_001085792.1.100888 WP_001085792.1.100903 WP_001085792.1.100920 WP_001085792.1.100922 WP_001085792.1.100934 WP_001085792.1.100963 WP_001085792.1.10097 WP_001085792.1.100981 WP_001085792.1.100987 WP_001085792.1.101002 WP_001085792.1.101015 WP_001085792.1.101017 WP_001085792.1.101019 WP_001085792.1.101027 WP_001085792.1.101055 WP_001085792.1.101058 WP_001085792.1.101068 WP_001085792.1.101071 WP_001085792.1.101072 WP_001085792.1.101084 WP_001085792.1.101103 WP_001085792.1.10111 WP_001085792.1.101142 WP_001085792.1.101160 WP_001085792.1.101177 WP_001085792.1.101192 WP_001085792.1.101217 WP_001085792.1.101240 WP_001085792.1.101262 WP_001085792.1.101266 WP_001085792.1.101298 WP_001085792.1.101327 WP_001085792.1.101329 WP_001085792.1.101330 WP_001085792.1.101352 WP_001085792.1.101375 WP_001085792.1.101379 WP_001085792.1.101393 WP_001085792.1.101397 WP_001085792.1.101406 WP_001085792.1.101414 WP_001085792.1.101440 WP_001085792.1.101441 WP_001085792.1.101458 WP_001085792.1.10148 WP_001085792.1.101490 WP_001085792.1.101495 WP_001085792.1.101505 WP_001085792.1.101511 WP_001085792.1.101531 WP_001085792.1.101566 WP_001085792.1.101567 WP_001085792.1.101570 WP_001085792.1.101598 WP_001085792.1.101617 WP_001085792.1.10165 WP_001085792.1.10166 WP_001085792.1.101661 WP_001085792.1.101670 WP_001085792.1.101691 WP_001085792.1.101704 WP_001085792.1.101725 WP_001085792.1.101728 WP_001085792.1.101745 WP_001085792.1.101757 WP_001085792.1.101758 WP_001085792.1.101775 WP_001085792.1.101778 WP_001085792.1.10178 WP_001085792.1.101788 WP_001085792.1.101813 WP_001085792.1.101820 WP_001085792.1.101821 WP_001085792.1.101825 WP_001085792.1.101852 WP_001085792.1.101902 WP_001085792.1.101906 WP_001085792.1.101922 WP_001085792.1.101943 WP_001085792.1.101999 WP_001085792.1.102065 WP_001085792.1.102066 WP_001085792.1.102070 WP_001085792.1.102084 WP_001085792.1.10209 WP_001085792.1.102096 WP_001085792.1.102123 WP_001085792.1.102126 WP_001085792.1.102130 WP_001085792.1.102132 WP_001085792.1.1022 WP_001085792.1.10232 WP_001085792.1.10238 WP_001085792.1.1025 WP_001085792.1.10274 WP_001085792.1.10301 WP_001085792.1.10306 WP_001085792.1.10308 WP_001085792.1.1031 WP_001085792.1.1032 WP_001085792.1.10340 WP_001085792.1.10343 WP_001085792.1.10358 WP_001085792.1.10397 WP_001085792.1.10408 WP_001085792.1.1043 WP_001085792.1.10431 WP_001085792.1.10436 WP_001085792.1.10469 WP_001085792.1.10478 WP_001085792.1.10481 WP_001085792.1.10486 WP_001085792.1.10503 WP_001085792.1.1052 WP_001085792.1.10526 WP_001085792.1.10543 WP_001085792.1.10565 WP_001085792.1.10583 WP_001085792.1.1060 WP_001085792.1.10614 WP_001085792.1.10617 WP_001085792.1.10624 WP_001085792.1.10644 WP_001085792.1.10679 WP_001085792.1.10726 WP_001085792.1.10742 WP_001085792.1.10749 WP_001085792.1.10751 WP_001085792.1.1077 WP_001085792.1.10783 WP_001085792.1.10785 WP_001085792.1.10823 WP_001085792.1.10841 WP_001085792.1.10843 WP_001085792.1.10858 WP_001085792.1.1087 WP_001085792.1.10919 WP_001085792.1.10928 WP_001085792.1.10942 WP_001085792.1.10950 WP_001085792.1.10969 WP_001085792.1.1097 WP_001085792.1.10976 WP_001085792.1.10979 WP_001085792.1.10985 WP_001085792.1.11001 WP_001085792.1.11067 WP_001085792.1.11069 WP_001085792.1.11073 WP_001085792.1.11076 WP_001085792.1.11080 WP_001085792.1.11083 WP_001085792.1.11084 WP_001085792.1.11129 WP_001085792.1.1115 WP_001085792.1.11162 WP_001085792.1.11188 WP_001085792.1.1120 WP_001085792.1.11220 WP_001085792.1.11223 WP_001085792.1.11228 WP_001085792.1.11234 WP_001085792.1.1124 WP_001085792.1.11261 WP_001085792.1.11281 WP_001085792.1.11282 WP_001085792.1.11286 WP_001085792.1.11287 WP_001085792.1.11294 WP_001085792.1.11322 WP_001085792.1.11333 WP_001085792.1.11348 WP_001085792.1.11353 WP_001085792.1.1136 WP_001085792.1.11377 WP_001085792.1.11378 WP_001085792.1.11403 WP_001085792.1.11407 WP_001085792.1.11447 WP_001085792.1.11451 WP_001085792.1.11463 WP_001085792.1.1147 WP_001085792.1.11475 WP_001085792.1.11488 WP_001085792.1.11492 WP_001085792.1.11494 WP_001085792.1.11504 WP_001085792.1.11513 WP_001085792.1.11525 WP_001085792.1.11556 WP_001085792.1.11558 WP_001085792.1.11571 WP_001085792.1.11592 WP_001085792.1.11611 WP_001085792.1.11625 WP_001085792.1.11640 WP_001085792.1.11646 WP_001085792.1.11655 WP_001085792.1.11660 WP_001085792.1.11663 WP_001085792.1.11665 WP_001085792.1.11692 WP_001085792.1.117 WP_001085792.1.1171 WP_001085792.1.11719 WP_001085792.1.11720 WP_001085792.1.11730 WP_001085792.1.11736 WP_001085792.1.11741 WP_001085792.1.11768 WP_001085792.1.11781 WP_001085792.1.11794 WP_001085792.1.11795 WP_001085792.1.11816 WP_001085792.1.11828 WP_001085792.1.11829 WP_001085792.1.11837 WP_001085792.1.11884 WP_001085792.1.11894 WP_001085792.1.11903 WP_001085792.1.11919 WP_001085792.1.11991 WP_001085792.1.12005 WP_001085792.1.12019 WP_001085792.1.12042 WP_001085792.1.1205 WP_001085792.1.12073 WP_001085792.1.12098 WP_001085792.1.1210 WP_001085792.1.12123 WP_001085792.1.12137 WP_001085792.1.12149 WP_001085792.1.12152 WP_001085792.1.12158 WP_001085792.1.12170 WP_001085792.1.12175 WP_001085792.1.12179 WP_001085792.1.12181 WP_001085792.1.12193 WP_001085792.1.12194 WP_001085792.1.12226 WP_001085792.1.12233 WP_001085792.1.12234 WP_001085792.1.12256 WP_001085792.1.12272 WP_001085792.1.12297 WP_001085792.1.12328 WP_001085792.1.12330 WP_001085792.1.12353 WP_001085792.1.12361 WP_001085792.1.12366 WP_001085792.1.12391 WP_001085792.1.12436 WP_001085792.1.12437 WP_001085792.1.12447 WP_001085792.1.12498 WP_001085792.1.12508 WP_001085792.1.1252 WP_001085792.1.1253 WP_001085792.1.12555 WP_001085792.1.1257 WP_001085792.1.12597 WP_001085792.1.12598 WP_001085792.1.12605 WP_001085792.1.12608 WP_001085792.1.12618 WP_001085792.1.12639 WP_001085792.1.12668 WP_001085792.1.12685 WP_001085792.1.12705 WP_001085792.1.12707 WP_001085792.1.12715 WP_001085792.1.12733 WP_001085792.1.12737 WP_001085792.1.12770 WP_001085792.1.12771 WP_001085792.1.12780 WP_001085792.1.12788 WP_001085792.1.12802 WP_001085792.1.12822 WP_001085792.1.12829 WP_001085792.1.12833 WP_001085792.1.12845 WP_001085792.1.12858 WP_001085792.1.12862 WP_001085792.1.12884 WP_001085792.1.12903 WP_001085792.1.12904 WP_001085792.1.12918 WP_001085792.1.12920 WP_001085792.1.12937 WP_001085792.1.12938 WP_001085792.1.12951 WP_001085792.1.12977 WP_001085792.1.13013 WP_001085792.1.13039 WP_001085792.1.13062 WP_001085792.1.13072 WP_001085792.1.13091 WP_001085792.1.13104 WP_001085792.1.13112 WP_001085792.1.13154 WP_001085792.1.13164 WP_001085792.1.13169 WP_001085792.1.13170 WP_001085792.1.13189 WP_001085792.1.13228 WP_001085792.1.13241 WP_001085792.1.13243 WP_001085792.1.13250 WP_001085792.1.13303 WP_001085792.1.13307 WP_001085792.1.13317 WP_001085792.1.13322 WP_001085792.1.13326 WP_001085792.1.13336 WP_001085792.1.13355 WP_001085792.1.13366 WP_001085792.1.13376 WP_001085792.1.13379 WP_001085792.1.13405 WP_001085792.1.13448 WP_001085792.1.13468 WP_001085792.1.1347 WP_001085792.1.13486 WP_001085792.1.13505 WP_001085792.1.13514 WP_001085792.1.13531 WP_001085792.1.1355 WP_001085792.1.13554 WP_001085792.1.13556 WP_001085792.1.13568 WP_001085792.1.13598 WP_001085792.1.13612 WP_001085792.1.13617 WP_001085792.1.13650 WP_001085792.1.13654 WP_001085792.1.13665 WP_001085792.1.13668 WP_001085792.1.13670 WP_001085792.1.13679 WP_001085792.1.13680 WP_001085792.1.13683 WP_001085792.1.13709 WP_001085792.1.13726 WP_001085792.1.13727 WP_001085792.1.13728 WP_001085792.1.13733 WP_001085792.1.1374 WP_001085792.1.13755 WP_001085792.1.13757 WP_001085792.1.13769 WP_001085792.1.13772 WP_001085792.1.13804 WP_001085792.1.13807 WP_001085792.1.13870 WP_001085792.1.13879 WP_001085792.1.13884 WP_001085792.1.13897 WP_001085792.1.13914 WP_001085792.1.13933 WP_001085792.1.13940 WP_001085792.1.13948 WP_001085792.1.13983 WP_001085792.1.13986 WP_001085792.1.13987 WP_001085792.1.14010 WP_001085792.1.14025 WP_001085792.1.14071 WP_001085792.1.14076 WP_001085792.1.14097 WP_001085792.1.14112 WP_001085792.1.14143 WP_001085792.1.14153 WP_001085792.1.14163 WP_001085792.1.1418 WP_001085792.1.1420 WP_001085792.1.14201 WP_001085792.1.14221 WP_001085792.1.14233 WP_001085792.1.1425 WP_001085792.1.1426 WP_001085792.1.14272 WP_001085792.1.1429 WP_001085792.1.14298 WP_001085792.1.14305 WP_001085792.1.14314 WP_001085792.1.14337 WP_001085792.1.14342 WP_001085792.1.14349 WP_001085792.1.14358 WP_001085792.1.14363 WP_001085792.1.14364 WP_001085792.1.14366 WP_001085792.1.14397 WP_001085792.1.14412 WP_001085792.1.14418 WP_001085792.1.14475 WP_001085792.1.14535 WP_001085792.1.14546 WP_001085792.1.1457 WP_001085792.1.14577 WP_001085792.1.14590 WP_001085792.1.14596 WP_001085792.1.14639 WP_001085792.1.14665 WP_001085792.1.14666 WP_001085792.1.1468 WP_001085792.1.14681 WP_001085792.1.14696 WP_001085792.1.147 WP_001085792.1.1471 WP_001085792.1.14729 WP_001085792.1.14734 WP_001085792.1.14744 WP_001085792.1.14747 WP_001085792.1.1477 WP_001085792.1.14770 WP_001085792.1.14774 WP_001085792.1.14782 WP_001085792.1.14790 WP_001085792.1.14809 WP_001085792.1.14825 WP_001085792.1.14845 WP_001085792.1.14846 WP_001085792.1.14868 WP_001085792.1.14869 WP_001085792.1.14874 WP_001085792.1.14888 WP_001085792.1.1490 WP_001085792.1.14902 WP_001085792.1.14924 WP_001085792.1.14925 WP_001085792.1.14967 WP_001085792.1.14970 WP_001085792.1.14987 WP_001085792.1.15000 WP_001085792.1.15015 WP_001085792.1.15029 WP_001085792.1.15071 WP_001085792.1.15091 WP_001085792.1.15098 WP_001085792.1.15108 WP_001085792.1.15150 WP_001085792.1.15173 WP_001085792.1.15185 WP_001085792.1.1520 WP_001085792.1.15201 WP_001085792.1.15206 WP_001085792.1.15228 WP_001085792.1.15241 WP_001085792.1.1525 WP_001085792.1.15255 WP_001085792.1.15263 WP_001085792.1.15268 WP_001085792.1.15269 WP_001085792.1.15278 WP_001085792.1.15294 WP_001085792.1.15296 WP_001085792.1.15329 WP_001085792.1.15389 WP_001085792.1.15399 WP_001085792.1.15403 WP_001085792.1.15409 WP_001085792.1.15421 WP_001085792.1.15438 WP_001085792.1.1545 WP_001085792.1.15478 WP_001085792.1.15489 WP_001085792.1.15505 WP_001085792.1.15524 WP_001085792.1.15532 WP_001085792.1.15533 WP_001085792.1.15544 WP_001085792.1.15546 WP_001085792.1.15572 WP_001085792.1.1558 WP_001085792.1.15590 WP_001085792.1.15591 WP_001085792.1.15601 WP_001085792.1.1564 WP_001085792.1.15641 WP_001085792.1.15679 WP_001085792.1.15685 WP_001085792.1.15687 WP_001085792.1.1569 WP_001085792.1.15691 WP_001085792.1.15706 WP_001085792.1.15712 WP_001085792.1.15722 WP_001085792.1.15753 WP_001085792.1.15785 WP_001085792.1.1579 WP_001085792.1.15812 WP_001085792.1.15818 WP_001085792.1.15819 WP_001085792.1.1583 WP_001085792.1.15838 WP_001085792.1.15858 WP_001085792.1.1586 WP_001085792.1.15883 WP_001085792.1.15888 WP_001085792.1.15892 WP_001085792.1.15897 WP_001085792.1.15898 WP_001085792.1.159 WP_001085792.1.15920 WP_001085792.1.15921 WP_001085792.1.15925 WP_001085792.1.15928 WP_001085792.1.15939 WP_001085792.1.15948 WP_001085792.1.15957 WP_001085792.1.15972 WP_001085792.1.1600 WP_001085792.1.16018 WP_001085792.1.16026 WP_001085792.1.1606 WP_001085792.1.16068 WP_001085792.1.16079 WP_001085792.1.16083 WP_001085792.1.16096 WP_001085792.1.16098 WP_001085792.1.16112 WP_001085792.1.16114 WP_001085792.1.16140 WP_001085792.1.16157 WP_001085792.1.16173 WP_001085792.1.16195 WP_001085792.1.16203 WP_001085792.1.16213 WP_001085792.1.16214 WP_001085792.1.16223 WP_001085792.1.1623 WP_001085792.1.16237 WP_001085792.1.16251 WP_001085792.1.16265 WP_001085792.1.16276 WP_001085792.1.16311 WP_001085792.1.16362 WP_001085792.1.16372 WP_001085792.1.16395 WP_001085792.1.16399 WP_001085792.1.16407 WP_001085792.1.16408 WP_001085792.1.16414 WP_001085792.1.16417 WP_001085792.1.16436 WP_001085792.1.16455 WP_001085792.1.16458 WP_001085792.1.16467 WP_001085792.1.16471 WP_001085792.1.16478 WP_001085792.1.16554 WP_001085792.1.16564 WP_001085792.1.16569 WP_001085792.1.16589 WP_001085792.1.16603 WP_001085792.1.16617 WP_001085792.1.16628 WP_001085792.1.16632 WP_001085792.1.16639 WP_001085792.1.1665 WP_001085792.1.16651 WP_001085792.1.16653 WP_001085792.1.1666 WP_001085792.1.16672 WP_001085792.1.16688 WP_001085792.1.16693 WP_001085792.1.16703 WP_001085792.1.16747 WP_001085792.1.16761 WP_001085792.1.16768 WP_001085792.1.16770 WP_001085792.1.16776 WP_001085792.1.16794 WP_001085792.1.16802 WP_001085792.1.16815 WP_001085792.1.16824 WP_001085792.1.16880 WP_001085792.1.16882 WP_001085792.1.16892 WP_001085792.1.16920 WP_001085792.1.16925 WP_001085792.1.16946 WP_001085792.1.16969 WP_001085792.1.16986 WP_001085792.1.170 WP_001085792.1.17009 WP_001085792.1.17012 WP_001085792.1.17038 WP_001085792.1.17046 WP_001085792.1.17050 WP_001085792.1.17080 WP_001085792.1.17104 WP_001085792.1.17122 WP_001085792.1.17132 WP_001085792.1.17137 WP_001085792.1.17139 WP_001085792.1.17143 WP_001085792.1.17156 WP_001085792.1.17157 WP_001085792.1.17176 WP_001085792.1.17180 WP_001085792.1.17201 WP_001085792.1.17210 WP_001085792.1.17231 WP_001085792.1.17234 WP_001085792.1.17240 WP_001085792.1.17249 WP_001085792.1.1725 WP_001085792.1.17256 WP_001085792.1.17289 WP_001085792.1.1729 WP_001085792.1.17296 WP_001085792.1.17309 WP_001085792.1.17320 WP_001085792.1.17327 WP_001085792.1.1736 WP_001085792.1.1740 WP_001085792.1.1741 WP_001085792.1.17419 WP_001085792.1.17450 WP_001085792.1.17454 WP_001085792.1.17456 WP_001085792.1.17485 WP_001085792.1.1751 WP_001085792.1.17520 WP_001085792.1.17524 WP_001085792.1.17529 WP_001085792.1.17531 WP_001085792.1.1756 WP_001085792.1.17569 WP_001085792.1.17581 WP_001085792.1.17590 WP_001085792.1.17640 WP_001085792.1.17643 WP_001085792.1.1765 WP_001085792.1.17650 WP_001085792.1.17657 WP_001085792.1.17666 WP_001085792.1.17671 WP_001085792.1.17676 WP_001085792.1.17717 WP_001085792.1.17718 WP_001085792.1.17725 WP_001085792.1.17729 WP_001085792.1.17737 WP_001085792.1.17770 WP_001085792.1.17796 WP_001085792.1.17817 WP_001085792.1.17818 WP_001085792.1.17832 WP_001085792.1.17834 WP_001085792.1.17845 WP_001085792.1.17847 WP_001085792.1.17853 WP_001085792.1.17859 WP_001085792.1.17876 WP_001085792.1.17909 WP_001085792.1.17922 WP_001085792.1.17928 WP_001085792.1.17929 WP_001085792.1.17943 WP_001085792.1.17951 WP_001085792.1.17974 WP_001085792.1.17987 WP_001085792.1.18011 WP_001085792.1.18016 WP_001085792.1.18035 WP_001085792.1.18043 WP_001085792.1.18069 WP_001085792.1.18074 WP_001085792.1.18080 WP_001085792.1.18105 WP_001085792.1.1811 WP_001085792.1.18113 WP_001085792.1.18132 WP_001085792.1.18140 WP_001085792.1.18153 WP_001085792.1.18203 WP_001085792.1.18237 WP_001085792.1.18248 WP_001085792.1.18261 WP_001085792.1.18273 WP_001085792.1.18283 WP_001085792.1.18288 WP_001085792.1.1829 WP_001085792.1.18290 WP_001085792.1.18301 WP_001085792.1.18309 WP_001085792.1.18310 WP_001085792.1.18320 WP_001085792.1.18346 WP_001085792.1.1835 WP_001085792.1.18360 WP_001085792.1.18412 WP_001085792.1.18424 WP_001085792.1.18429 WP_001085792.1.18437 WP_001085792.1.18451 WP_001085792.1.1847 WP_001085792.1.18487 WP_001085792.1.1849 WP_001085792.1.18495 WP_001085792.1.185 WP_001085792.1.18506 WP_001085792.1.18507 WP_001085792.1.1851 WP_001085792.1.18516 WP_001085792.1.18526 WP_001085792.1.18527 WP_001085792.1.18529 WP_001085792.1.18538 WP_001085792.1.18539 WP_001085792.1.18560 WP_001085792.1.18562 WP_001085792.1.18567 WP_001085792.1.18570 WP_001085792.1.18590 WP_001085792.1.18591 WP_001085792.1.18605 WP_001085792.1.18611 WP_001085792.1.18627 WP_001085792.1.18632 WP_001085792.1.18656 WP_001085792.1.18658 WP_001085792.1.18668 WP_001085792.1.18679 WP_001085792.1.18719 WP_001085792.1.18741 WP_001085792.1.18758 WP_001085792.1.18777 WP_001085792.1.18792 WP_001085792.1.18799 WP_001085792.1.18809 WP_001085792.1.18818 WP_001085792.1.18819 WP_001085792.1.18834 WP_001085792.1.18836 WP_001085792.1.18870 WP_001085792.1.18879 WP_001085792.1.18882 WP_001085792.1.18918 WP_001085792.1.1892 WP_001085792.1.18938 WP_001085792.1.18963 WP_001085792.1.18965 WP_001085792.1.18968 WP_001085792.1.18974 WP_001085792.1.18987 WP_001085792.1.18996 WP_001085792.1.19009 WP_001085792.1.1901 WP_001085792.1.19014 WP_001085792.1.19022 WP_001085792.1.19027 WP_001085792.1.19052 WP_001085792.1.19082 WP_001085792.1.19102 WP_001085792.1.19109 WP_001085792.1.1911 WP_001085792.1.1912 WP_001085792.1.19149 WP_001085792.1.19179 WP_001085792.1.192 WP_001085792.1.1921 WP_001085792.1.19259 WP_001085792.1.19272 WP_001085792.1.19301 WP_001085792.1.19306 WP_001085792.1.19322 WP_001085792.1.19370 WP_001085792.1.19375 WP_001085792.1.19377 WP_001085792.1.19399 WP_001085792.1.1940 WP_001085792.1.1943 WP_001085792.1.19430 WP_001085792.1.19444 WP_001085792.1.19450 WP_001085792.1.19509 WP_001085792.1.19537 WP_001085792.1.19555 WP_001085792.1.19575 WP_001085792.1.19577 WP_001085792.1.19611 WP_001085792.1.1962 WP_001085792.1.1964 WP_001085792.1.19643 WP_001085792.1.19653 WP_001085792.1.19700 WP_001085792.1.19701 WP_001085792.1.19725 WP_001085792.1.19732 WP_001085792.1.19733 WP_001085792.1.1974 WP_001085792.1.19748 WP_001085792.1.1975 WP_001085792.1.19759 WP_001085792.1.19765 WP_001085792.1.19775 WP_001085792.1.19788 WP_001085792.1.19792 WP_001085792.1.19807 WP_001085792.1.19816 WP_001085792.1.19848 WP_001085792.1.19853 WP_001085792.1.19881 WP_001085792.1.19891 WP_001085792.1.19904 WP_001085792.1.19912 WP_001085792.1.19921 WP_001085792.1.19928 WP_001085792.1.19974 WP_001085792.1.19977 WP_001085792.1.19980 WP_001085792.1.19981 WP_001085792.1.19982 WP_001085792.1.2 WP_001085792.1.20006 WP_001085792.1.20049 WP_001085792.1.20052 WP_001085792.1.20057 WP_001085792.1.2007 WP_001085792.1.20078 WP_001085792.1.2008 WP_001085792.1.20090 WP_001085792.1.20100 WP_001085792.1.20101 WP_001085792.1.2013 WP_001085792.1.20155 WP_001085792.1.20156 WP_001085792.1.20160 WP_001085792.1.20161 WP_001085792.1.20167 WP_001085792.1.20177 WP_001085792.1.20191 WP_001085792.1.20201 WP_001085792.1.20210 WP_001085792.1.20214 WP_001085792.1.20235 WP_001085792.1.20245 WP_001085792.1.20265 WP_001085792.1.2029 WP_001085792.1.20307 WP_001085792.1.20324 WP_001085792.1.20340 WP_001085792.1.20386 WP_001085792.1.20394 WP_001085792.1.20398 WP_001085792.1.20399 WP_001085792.1.20411 WP_001085792.1.20447 WP_001085792.1.20473 WP_001085792.1.20479 WP_001085792.1.20487 WP_001085792.1.20496 WP_001085792.1.20500 WP_001085792.1.20550 WP_001085792.1.20554 WP_001085792.1.20558 WP_001085792.1.20574 WP_001085792.1.20579 WP_001085792.1.20585 WP_001085792.1.20611 WP_001085792.1.20619 WP_001085792.1.20620 WP_001085792.1.20649 WP_001085792.1.20661 WP_001085792.1.20690 WP_001085792.1.20698 WP_001085792.1.20736 WP_001085792.1.20772 WP_001085792.1.2079 WP_001085792.1.20796 WP_001085792.1.20821 WP_001085792.1.20833 WP_001085792.1.20838 WP_001085792.1.20846 WP_001085792.1.20860 WP_001085792.1.20867 WP_001085792.1.20878 WP_001085792.1.20913 WP_001085792.1.20922 WP_001085792.1.20935 WP_001085792.1.20939 WP_001085792.1.20945 WP_001085792.1.20971 WP_001085792.1.20975 WP_001085792.1.20979 WP_001085792.1.21009 WP_001085792.1.21013 WP_001085792.1.21031 WP_001085792.1.21054 WP_001085792.1.21056 WP_001085792.1.21064 WP_001085792.1.21066 WP_001085792.1.21078 WP_001085792.1.21080 WP_001085792.1.21081 WP_001085792.1.21102 WP_001085792.1.21109 WP_001085792.1.21111 WP_001085792.1.21154 WP_001085792.1.21183 WP_001085792.1.2119 WP_001085792.1.21257 WP_001085792.1.21272 WP_001085792.1.2128 WP_001085792.1.2129 WP_001085792.1.21312 WP_001085792.1.21313 WP_001085792.1.21330 WP_001085792.1.21339 WP_001085792.1.2135 WP_001085792.1.21356 WP_001085792.1.21359 WP_001085792.1.21375 WP_001085792.1.21379 WP_001085792.1.21386 WP_001085792.1.21393 WP_001085792.1.21402 WP_001085792.1.21412 WP_001085792.1.21449 WP_001085792.1.21458 WP_001085792.1.21464 WP_001085792.1.21465 WP_001085792.1.21477 WP_001085792.1.21480 WP_001085792.1.21500 WP_001085792.1.21511 WP_001085792.1.21514 WP_001085792.1.21536 WP_001085792.1.2154 WP_001085792.1.21572 WP_001085792.1.21583 WP_001085792.1.2159 WP_001085792.1.2160 WP_001085792.1.21601 WP_001085792.1.21621 WP_001085792.1.21636 WP_001085792.1.21679 WP_001085792.1.21712 WP_001085792.1.21724 WP_001085792.1.21746 WP_001085792.1.21763 WP_001085792.1.2178 WP_001085792.1.21787 WP_001085792.1.21820 WP_001085792.1.21830 WP_001085792.1.21890 WP_001085792.1.21894 WP_001085792.1.21901 WP_001085792.1.21919 WP_001085792.1.21954 WP_001085792.1.21988 WP_001085792.1.22022 WP_001085792.1.22027 WP_001085792.1.22045 WP_001085792.1.22065 WP_001085792.1.22082 WP_001085792.1.22093 WP_001085792.1.2211 WP_001085792.1.22111 WP_001085792.1.22149 WP_001085792.1.22163 WP_001085792.1.22165 WP_001085792.1.22170 WP_001085792.1.22174 WP_001085792.1.22177 WP_001085792.1.22180 WP_001085792.1.22197 WP_001085792.1.22200 WP_001085792.1.22227 WP_001085792.1.22237 WP_001085792.1.22246 WP_001085792.1.22259 WP_001085792.1.22300 WP_001085792.1.22302 WP_001085792.1.22307 WP_001085792.1.22332 WP_001085792.1.22344 WP_001085792.1.22345 WP_001085792.1.22351 WP_001085792.1.22367 WP_001085792.1.22369 WP_001085792.1.22400 WP_001085792.1.22418 WP_001085792.1.22493 WP_001085792.1.22512 WP_001085792.1.22526 WP_001085792.1.22531 WP_001085792.1.22533 WP_001085792.1.22547 WP_001085792.1.22551 WP_001085792.1.22559 WP_001085792.1.22650 WP_001085792.1.22657 WP_001085792.1.22684 WP_001085792.1.22696 WP_001085792.1.22702 WP_001085792.1.22709 WP_001085792.1.22714 WP_001085792.1.22727 WP_001085792.1.22730 WP_001085792.1.22738 WP_001085792.1.22739 WP_001085792.1.22789 WP_001085792.1.22790 WP_001085792.1.22792 WP_001085792.1.2280 WP_001085792.1.22803 WP_001085792.1.22808 WP_001085792.1.22811 WP_001085792.1.22843 WP_001085792.1.22853 WP_001085792.1.22859 WP_001085792.1.22861 WP_001085792.1.22869 WP_001085792.1.22890 WP_001085792.1.22969 WP_001085792.1.22975 WP_001085792.1.22994 WP_001085792.1.23004 WP_001085792.1.23008 WP_001085792.1.23048 WP_001085792.1.23061 WP_001085792.1.23069 WP_001085792.1.23082 WP_001085792.1.23103 WP_001085792.1.23121 WP_001085792.1.23130 WP_001085792.1.23132 WP_001085792.1.23133 WP_001085792.1.23152 WP_001085792.1.23161 WP_001085792.1.23185 WP_001085792.1.23194 WP_001085792.1.23197 WP_001085792.1.23217 WP_001085792.1.23222 WP_001085792.1.23228 WP_001085792.1.23238 WP_001085792.1.23244 WP_001085792.1.2327 WP_001085792.1.23275 WP_001085792.1.23288 WP_001085792.1.23381 WP_001085792.1.23413 WP_001085792.1.23420 WP_001085792.1.23431 WP_001085792.1.23439 WP_001085792.1.23449 WP_001085792.1.23450 WP_001085792.1.23489 WP_001085792.1.23491 WP_001085792.1.23516 WP_001085792.1.23531 WP_001085792.1.23541 WP_001085792.1.23544 WP_001085792.1.23557 WP_001085792.1.23568 WP_001085792.1.23572 WP_001085792.1.23580 WP_001085792.1.23586 WP_001085792.1.23613 WP_001085792.1.23617 WP_001085792.1.23630 WP_001085792.1.23644 WP_001085792.1.23690 WP_001085792.1.23710 WP_001085792.1.23740 WP_001085792.1.23796 WP_001085792.1.23809 WP_001085792.1.2382 WP_001085792.1.23822 WP_001085792.1.23842 WP_001085792.1.23849 WP_001085792.1.23856 WP_001085792.1.2389 WP_001085792.1.23896 WP_001085792.1.23900 WP_001085792.1.23902 WP_001085792.1.23907 WP_001085792.1.23935 WP_001085792.1.23944 WP_001085792.1.23956 WP_001085792.1.23972 WP_001085792.1.23995 WP_001085792.1.23998 WP_001085792.1.24000 WP_001085792.1.24129 WP_001085792.1.24148 WP_001085792.1.24167 WP_001085792.1.24174 WP_001085792.1.2420 WP_001085792.1.24207 WP_001085792.1.24213 WP_001085792.1.2423 WP_001085792.1.24241 WP_001085792.1.24263 WP_001085792.1.2427 WP_001085792.1.24275 WP_001085792.1.24277 WP_001085792.1.24279 WP_001085792.1.2434 WP_001085792.1.24343 WP_001085792.1.24347 WP_001085792.1.24364 WP_001085792.1.24388 WP_001085792.1.24416 WP_001085792.1.24418 WP_001085792.1.2442 WP_001085792.1.24436 WP_001085792.1.24437 WP_001085792.1.24439 WP_001085792.1.24443 WP_001085792.1.24456 WP_001085792.1.24462 WP_001085792.1.24469 WP_001085792.1.24478 WP_001085792.1.2450 WP_001085792.1.24502 WP_001085792.1.24503 WP_001085792.1.24519 WP_001085792.1.2458 WP_001085792.1.24589 WP_001085792.1.24596 WP_001085792.1.24597 WP_001085792.1.24602 WP_001085792.1.24617 WP_001085792.1.24631 WP_001085792.1.24644 WP_001085792.1.24679 WP_001085792.1.24681 WP_001085792.1.24684 WP_001085792.1.24685 WP_001085792.1.24702 WP_001085792.1.24780 WP_001085792.1.24781 WP_001085792.1.2480 WP_001085792.1.24802 WP_001085792.1.24817 WP_001085792.1.24823 WP_001085792.1.24855 WP_001085792.1.24856 WP_001085792.1.24891 WP_001085792.1.24903 WP_001085792.1.24915 WP_001085792.1.24918 WP_001085792.1.2497 WP_001085792.1.25007 WP_001085792.1.2501 WP_001085792.1.25012 WP_001085792.1.25029 WP_001085792.1.2506 WP_001085792.1.25070 WP_001085792.1.25083 WP_001085792.1.25092 WP_001085792.1.25095 WP_001085792.1.25098 WP_001085792.1.25115 WP_001085792.1.25117 WP_001085792.1.25120 WP_001085792.1.25145 WP_001085792.1.25167 WP_001085792.1.25170 WP_001085792.1.25187 WP_001085792.1.25209 WP_001085792.1.2522 WP_001085792.1.25262 WP_001085792.1.25287 WP_001085792.1.25331 WP_001085792.1.25361 WP_001085792.1.25433 WP_001085792.1.25438 WP_001085792.1.2544 WP_001085792.1.25459 WP_001085792.1.25469 WP_001085792.1.25479 WP_001085792.1.25488 WP_001085792.1.25489 WP_001085792.1.25495 WP_001085792.1.25511 WP_001085792.1.2552 WP_001085792.1.25557 WP_001085792.1.25567 WP_001085792.1.25591 WP_001085792.1.25593 WP_001085792.1.25595 WP_001085792.1.25597 WP_001085792.1.25621 WP_001085792.1.25623 WP_001085792.1.25632 WP_001085792.1.25633 WP_001085792.1.25634 WP_001085792.1.25721 WP_001085792.1.25737 WP_001085792.1.25744 WP_001085792.1.25758 WP_001085792.1.25770 WP_001085792.1.25772 WP_001085792.1.25776 WP_001085792.1.25779 WP_001085792.1.2579 WP_001085792.1.25801 WP_001085792.1.25802 WP_001085792.1.25820 WP_001085792.1.25840 WP_001085792.1.25852 WP_001085792.1.25856 WP_001085792.1.25857 WP_001085792.1.25868 WP_001085792.1.25881 WP_001085792.1.25891 WP_001085792.1.2590 WP_001085792.1.25910 WP_001085792.1.25924 WP_001085792.1.2593 WP_001085792.1.25930 WP_001085792.1.25955 WP_001085792.1.25984 WP_001085792.1.26006 WP_001085792.1.26012 WP_001085792.1.26033 WP_001085792.1.26039 WP_001085792.1.2608 WP_001085792.1.26086 WP_001085792.1.26106 WP_001085792.1.26143 WP_001085792.1.26169 WP_001085792.1.26172 WP_001085792.1.2619 WP_001085792.1.262 WP_001085792.1.2621 WP_001085792.1.26226 WP_001085792.1.26255 WP_001085792.1.26266 WP_001085792.1.26276 WP_001085792.1.26289 WP_001085792.1.26290 WP_001085792.1.26293 WP_001085792.1.26298 WP_001085792.1.26306 WP_001085792.1.26307 WP_001085792.1.26314 WP_001085792.1.26315 WP_001085792.1.26318 WP_001085792.1.2633 WP_001085792.1.26340 WP_001085792.1.26345 WP_001085792.1.26346 WP_001085792.1.26354 WP_001085792.1.26359 WP_001085792.1.26364 WP_001085792.1.26370 WP_001085792.1.26390 WP_001085792.1.26397 WP_001085792.1.26399 WP_001085792.1.26404 WP_001085792.1.26405 WP_001085792.1.2643 WP_001085792.1.2645 WP_001085792.1.26481 WP_001085792.1.26506 WP_001085792.1.2656 WP_001085792.1.2658 WP_001085792.1.26584 WP_001085792.1.2661 WP_001085792.1.26626 WP_001085792.1.2664 WP_001085792.1.26650 WP_001085792.1.26662 WP_001085792.1.26663 WP_001085792.1.26677 WP_001085792.1.26692 WP_001085792.1.26726 WP_001085792.1.2673 WP_001085792.1.26733 WP_001085792.1.2674 WP_001085792.1.26749 WP_001085792.1.26751 WP_001085792.1.26771 WP_001085792.1.26772 WP_001085792.1.26790 WP_001085792.1.26804 WP_001085792.1.2684 WP_001085792.1.26840 WP_001085792.1.26850 WP_001085792.1.26865 WP_001085792.1.2687 WP_001085792.1.26884 WP_001085792.1.26886 WP_001085792.1.2689 WP_001085792.1.26903 WP_001085792.1.26905 WP_001085792.1.26927 WP_001085792.1.26929 WP_001085792.1.26938 WP_001085792.1.26944 WP_001085792.1.26958 WP_001085792.1.26963 WP_001085792.1.2697 WP_001085792.1.27013 WP_001085792.1.27053 WP_001085792.1.27080 WP_001085792.1.27083 WP_001085792.1.27097 WP_001085792.1.27120 WP_001085792.1.27127 WP_001085792.1.27154 WP_001085792.1.27166 WP_001085792.1.27168 WP_001085792.1.27170 WP_001085792.1.2718 WP_001085792.1.27182 WP_001085792.1.2719 WP_001085792.1.27199 WP_001085792.1.27207 WP_001085792.1.27237 WP_001085792.1.27246 WP_001085792.1.27262 WP_001085792.1.27293 WP_001085792.1.27294 WP_001085792.1.27311 WP_001085792.1.27323 WP_001085792.1.27333 WP_001085792.1.2734 WP_001085792.1.27345 WP_001085792.1.27379 WP_001085792.1.27387 WP_001085792.1.27415 WP_001085792.1.27447 WP_001085792.1.27448 WP_001085792.1.27455 WP_001085792.1.27456 WP_001085792.1.27457 WP_001085792.1.27467 WP_001085792.1.27468 WP_001085792.1.27516 WP_001085792.1.2753 WP_001085792.1.27539 WP_001085792.1.27551 WP_001085792.1.27562 WP_001085792.1.2759 WP_001085792.1.27590 WP_001085792.1.27608 WP_001085792.1.27614 WP_001085792.1.27615 WP_001085792.1.27621 WP_001085792.1.27622 WP_001085792.1.27628 WP_001085792.1.27640 WP_001085792.1.27646 WP_001085792.1.27654 WP_001085792.1.27662 WP_001085792.1.27667 WP_001085792.1.27670 WP_001085792.1.27673 WP_001085792.1.27689 WP_001085792.1.27696 WP_001085792.1.27739 WP_001085792.1.27744 WP_001085792.1.27748 WP_001085792.1.27765 WP_001085792.1.27787 WP_001085792.1.27793 WP_001085792.1.27799 WP_001085792.1.27817 WP_001085792.1.27830 WP_001085792.1.27834 WP_001085792.1.27854 WP_001085792.1.27929 WP_001085792.1.2795 WP_001085792.1.27950 WP_001085792.1.27953 WP_001085792.1.27972 WP_001085792.1.27999 WP_001085792.1.28007 WP_001085792.1.28016 WP_001085792.1.28025 WP_001085792.1.28063 WP_001085792.1.28071 WP_001085792.1.28079 WP_001085792.1.28081 WP_001085792.1.28088 WP_001085792.1.28091 WP_001085792.1.28105 WP_001085792.1.28117 WP_001085792.1.28138 WP_001085792.1.28147 WP_001085792.1.28158 WP_001085792.1.28173 WP_001085792.1.28191 WP_001085792.1.28207 WP_001085792.1.28213 WP_001085792.1.28226 WP_001085792.1.28230 WP_001085792.1.28253 WP_001085792.1.28257 WP_001085792.1.28274 WP_001085792.1.28298 WP_001085792.1.28315 WP_001085792.1.28319 WP_001085792.1.28334 WP_001085792.1.28347 WP_001085792.1.28358 WP_001085792.1.28360 WP_001085792.1.28376 WP_001085792.1.28381 WP_001085792.1.28388 WP_001085792.1.28399 WP_001085792.1.28400 WP_001085792.1.28430 WP_001085792.1.28447 WP_001085792.1.28477 WP_001085792.1.28482 WP_001085792.1.28498 WP_001085792.1.28501 WP_001085792.1.28502 WP_001085792.1.2852 WP_001085792.1.28526 WP_001085792.1.28527 WP_001085792.1.28532 WP_001085792.1.28564 WP_001085792.1.28578 WP_001085792.1.28580 WP_001085792.1.28584 WP_001085792.1.28605 WP_001085792.1.28614 WP_001085792.1.2862 WP_001085792.1.28629 WP_001085792.1.28650 WP_001085792.1.28652 WP_001085792.1.28672 WP_001085792.1.28675 WP_001085792.1.28690 WP_001085792.1.28691 WP_001085792.1.28710 WP_001085792.1.28720 WP_001085792.1.28763 WP_001085792.1.28784 WP_001085792.1.28785 WP_001085792.1.28848 WP_001085792.1.28862 WP_001085792.1.28866 WP_001085792.1.28871 WP_001085792.1.28887 WP_001085792.1.28909 WP_001085792.1.2891 WP_001085792.1.28915 WP_001085792.1.28925 WP_001085792.1.28933 WP_001085792.1.28934 WP_001085792.1.28960 WP_001085792.1.28970 WP_001085792.1.28981 WP_001085792.1.28987 WP_001085792.1.29014 WP_001085792.1.29052 WP_001085792.1.29060 WP_001085792.1.29090 WP_001085792.1.29107 WP_001085792.1.29112 WP_001085792.1.2913 WP_001085792.1.29155 WP_001085792.1.29166 WP_001085792.1.29170 WP_001085792.1.29187 WP_001085792.1.29188 WP_001085792.1.29207 WP_001085792.1.29226 WP_001085792.1.29242 WP_001085792.1.29243 WP_001085792.1.29244 WP_001085792.1.29250 WP_001085792.1.29263 WP_001085792.1.29268 WP_001085792.1.29272 WP_001085792.1.29276 WP_001085792.1.29282 WP_001085792.1.29285 WP_001085792.1.29301 WP_001085792.1.29312 WP_001085792.1.29315 WP_001085792.1.29329 WP_001085792.1.29366 WP_001085792.1.29368 WP_001085792.1.29372 WP_001085792.1.29373 WP_001085792.1.29381 WP_001085792.1.29395 WP_001085792.1.29420 WP_001085792.1.29445 WP_001085792.1.29468 WP_001085792.1.29507 WP_001085792.1.29511 WP_001085792.1.29522 WP_001085792.1.29541 WP_001085792.1.29553 WP_001085792.1.29554 WP_001085792.1.29557 WP_001085792.1.29560 WP_001085792.1.29561 WP_001085792.1.2957 WP_001085792.1.29596 WP_001085792.1.29644 WP_001085792.1.29676 WP_001085792.1.29716 WP_001085792.1.2972 WP_001085792.1.29731 WP_001085792.1.29736 WP_001085792.1.29744 WP_001085792.1.29758 WP_001085792.1.29781 WP_001085792.1.29788 WP_001085792.1.29805 WP_001085792.1.2981 WP_001085792.1.29826 WP_001085792.1.2983 WP_001085792.1.29862 WP_001085792.1.29885 WP_001085792.1.29902 WP_001085792.1.29905 WP_001085792.1.29918 WP_001085792.1.29956 WP_001085792.1.29963 WP_001085792.1.2997 WP_001085792.1.29981 WP_001085792.1.29982 WP_001085792.1.30023 WP_001085792.1.30033 WP_001085792.1.30051 WP_001085792.1.30057 WP_001085792.1.30089 WP_001085792.1.30095 WP_001085792.1.30100 WP_001085792.1.30130 WP_001085792.1.30150 WP_001085792.1.30152 WP_001085792.1.30154 WP_001085792.1.30176 WP_001085792.1.30186 WP_001085792.1.30188 WP_001085792.1.30190 WP_001085792.1.30191 WP_001085792.1.30197 WP_001085792.1.30204 WP_001085792.1.30209 WP_001085792.1.30249 WP_001085792.1.30262 WP_001085792.1.30268 WP_001085792.1.30274 WP_001085792.1.3029 WP_001085792.1.30294 WP_001085792.1.30302 WP_001085792.1.30307 WP_001085792.1.30328 WP_001085792.1.30333 WP_001085792.1.30350 WP_001085792.1.30364 WP_001085792.1.30367 WP_001085792.1.30376 WP_001085792.1.30381 WP_001085792.1.30385 WP_001085792.1.30418 WP_001085792.1.30458 WP_001085792.1.30477 WP_001085792.1.30508 WP_001085792.1.30530 WP_001085792.1.30531 WP_001085792.1.30560 WP_001085792.1.30566 WP_001085792.1.30568 WP_001085792.1.30622 WP_001085792.1.30623 WP_001085792.1.30645 WP_001085792.1.30646 WP_001085792.1.30648 WP_001085792.1.30650 WP_001085792.1.30652 WP_001085792.1.30666 WP_001085792.1.30690 WP_001085792.1.30702 WP_001085792.1.30720 WP_001085792.1.30726 WP_001085792.1.30758 WP_001085792.1.30763 WP_001085792.1.30768 WP_001085792.1.3077 WP_001085792.1.30779 WP_001085792.1.30840 WP_001085792.1.30845 WP_001085792.1.30846 WP_001085792.1.30847 WP_001085792.1.30854 WP_001085792.1.30862 WP_001085792.1.30863 WP_001085792.1.30874 WP_001085792.1.30878 WP_001085792.1.30880 WP_001085792.1.30889 WP_001085792.1.30907 WP_001085792.1.30911 WP_001085792.1.30915 WP_001085792.1.30916 WP_001085792.1.30928 WP_001085792.1.30945 WP_001085792.1.3097 WP_001085792.1.30970 WP_001085792.1.30971 WP_001085792.1.30998 WP_001085792.1.31005 WP_001085792.1.31022 WP_001085792.1.31025 WP_001085792.1.31037 WP_001085792.1.31039 WP_001085792.1.31041 WP_001085792.1.31048 WP_001085792.1.31065 WP_001085792.1.31068 WP_001085792.1.31077 WP_001085792.1.31091 WP_001085792.1.31113 WP_001085792.1.31114 WP_001085792.1.31120 WP_001085792.1.31124 WP_001085792.1.31176 WP_001085792.1.31194 WP_001085792.1.31202 WP_001085792.1.31204 WP_001085792.1.31206 WP_001085792.1.31212 WP_001085792.1.3123 WP_001085792.1.31232 WP_001085792.1.31278 WP_001085792.1.31315 WP_001085792.1.3132 WP_001085792.1.31337 WP_001085792.1.31339 WP_001085792.1.31355 WP_001085792.1.31363 WP_001085792.1.31376 WP_001085792.1.31377 WP_001085792.1.31426 WP_001085792.1.31436 WP_001085792.1.31437 WP_001085792.1.31441 WP_001085792.1.31442 WP_001085792.1.31462 WP_001085792.1.31468 WP_001085792.1.31478 WP_001085792.1.31479 WP_001085792.1.31497 WP_001085792.1.315 WP_001085792.1.31505 WP_001085792.1.31529 WP_001085792.1.31539 WP_001085792.1.31567 WP_001085792.1.31568 WP_001085792.1.31589 WP_001085792.1.31605 WP_001085792.1.31611 WP_001085792.1.31621 WP_001085792.1.31638 WP_001085792.1.31642 WP_001085792.1.31647 WP_001085792.1.31653 WP_001085792.1.31667 WP_001085792.1.31686 WP_001085792.1.31701 WP_001085792.1.31743 WP_001085792.1.31753 WP_001085792.1.31787 WP_001085792.1.31791 WP_001085792.1.31797 WP_001085792.1.31816 WP_001085792.1.31817 WP_001085792.1.31827 WP_001085792.1.31828 WP_001085792.1.31842 WP_001085792.1.3188 WP_001085792.1.31892 WP_001085792.1.31897 WP_001085792.1.31925 WP_001085792.1.31931 WP_001085792.1.31943 WP_001085792.1.31949 WP_001085792.1.31990 WP_001085792.1.31994 WP_001085792.1.31997 WP_001085792.1.32003 WP_001085792.1.32005 WP_001085792.1.32029 WP_001085792.1.32040 WP_001085792.1.32059 WP_001085792.1.32067 WP_001085792.1.32077 WP_001085792.1.32095 WP_001085792.1.32106 WP_001085792.1.32118 WP_001085792.1.32122 WP_001085792.1.32125 WP_001085792.1.32130 WP_001085792.1.32160 WP_001085792.1.32167 WP_001085792.1.32207 WP_001085792.1.32217 WP_001085792.1.32244 WP_001085792.1.32248 WP_001085792.1.32269 WP_001085792.1.32281 WP_001085792.1.3229 WP_001085792.1.32295 WP_001085792.1.32301 WP_001085792.1.3231 WP_001085792.1.32339 WP_001085792.1.32348 WP_001085792.1.32365 WP_001085792.1.32384 WP_001085792.1.32405 WP_001085792.1.3242 WP_001085792.1.3244 WP_001085792.1.32454 WP_001085792.1.32464 WP_001085792.1.32474 WP_001085792.1.32481 WP_001085792.1.32483 WP_001085792.1.32497 WP_001085792.1.32514 WP_001085792.1.32517 WP_001085792.1.32534 WP_001085792.1.32546 WP_001085792.1.32555 WP_001085792.1.32565 WP_001085792.1.32584 WP_001085792.1.32588 WP_001085792.1.32599 WP_001085792.1.32607 WP_001085792.1.32634 WP_001085792.1.32645 WP_001085792.1.32746 WP_001085792.1.32761 WP_001085792.1.32763 WP_001085792.1.32764 WP_001085792.1.32770 WP_001085792.1.32800 WP_001085792.1.32829 WP_001085792.1.32898 WP_001085792.1.32921 WP_001085792.1.32928 WP_001085792.1.3293 WP_001085792.1.32939 WP_001085792.1.32954 WP_001085792.1.32965 WP_001085792.1.32987 WP_001085792.1.3299 WP_001085792.1.33029 WP_001085792.1.33038 WP_001085792.1.33048 WP_001085792.1.3306 WP_001085792.1.33067 WP_001085792.1.33108 WP_001085792.1.33110 WP_001085792.1.33123 WP_001085792.1.33138 WP_001085792.1.33147 WP_001085792.1.33172 WP_001085792.1.33212 WP_001085792.1.33213 WP_001085792.1.33250 WP_001085792.1.33252 WP_001085792.1.33255 WP_001085792.1.33266 WP_001085792.1.33277 WP_001085792.1.33292 WP_001085792.1.33296 WP_001085792.1.3330 WP_001085792.1.33307 WP_001085792.1.33322 WP_001085792.1.33328 WP_001085792.1.33335 WP_001085792.1.3335 WP_001085792.1.33350 WP_001085792.1.33357 WP_001085792.1.33372 WP_001085792.1.3338 WP_001085792.1.33388 WP_001085792.1.3341 WP_001085792.1.33416 WP_001085792.1.33426 WP_001085792.1.3343 WP_001085792.1.33432 WP_001085792.1.3345 WP_001085792.1.33463 WP_001085792.1.33468 WP_001085792.1.3347 WP_001085792.1.33483 WP_001085792.1.33484 WP_001085792.1.33507 WP_001085792.1.33520 WP_001085792.1.33538 WP_001085792.1.33567 WP_001085792.1.33575 WP_001085792.1.3358 WP_001085792.1.33594 WP_001085792.1.33607 WP_001085792.1.33610 WP_001085792.1.33626 WP_001085792.1.33627 WP_001085792.1.3363 WP_001085792.1.33640 WP_001085792.1.33650 WP_001085792.1.33654 WP_001085792.1.33655 WP_001085792.1.33692 WP_001085792.1.33695 WP_001085792.1.33707 WP_001085792.1.33718 WP_001085792.1.33724 WP_001085792.1.33735 WP_001085792.1.33743 WP_001085792.1.33756 WP_001085792.1.33765 WP_001085792.1.33766 WP_001085792.1.33767 WP_001085792.1.33769 WP_001085792.1.33778 WP_001085792.1.33792 WP_001085792.1.33804 WP_001085792.1.33813 WP_001085792.1.33816 WP_001085792.1.33850 WP_001085792.1.33899 WP_001085792.1.33940 WP_001085792.1.33949 WP_001085792.1.33963 WP_001085792.1.33966 WP_001085792.1.33968 WP_001085792.1.33971 WP_001085792.1.33983 WP_001085792.1.33989 WP_001085792.1.34026 WP_001085792.1.34030 WP_001085792.1.34051 WP_001085792.1.34060 WP_001085792.1.34062 WP_001085792.1.34069 WP_001085792.1.34078 WP_001085792.1.34080 WP_001085792.1.34089 WP_001085792.1.34100 WP_001085792.1.34105 WP_001085792.1.34112 WP_001085792.1.34128 WP_001085792.1.34132 WP_001085792.1.34168 WP_001085792.1.3417 WP_001085792.1.34172 WP_001085792.1.3418 WP_001085792.1.34182 WP_001085792.1.34194 WP_001085792.1.34209 WP_001085792.1.34223 WP_001085792.1.34240 WP_001085792.1.34244 WP_001085792.1.34250 WP_001085792.1.34251 WP_001085792.1.34254 WP_001085792.1.34280 WP_001085792.1.34285 WP_001085792.1.34307 WP_001085792.1.34334 WP_001085792.1.34361 WP_001085792.1.34371 WP_001085792.1.34381 WP_001085792.1.34403 WP_001085792.1.34410 WP_001085792.1.3442 WP_001085792.1.34427 WP_001085792.1.34436 WP_001085792.1.34438 WP_001085792.1.34471 WP_001085792.1.34473 WP_001085792.1.3448 WP_001085792.1.34482 WP_001085792.1.34492 WP_001085792.1.34502 WP_001085792.1.34510 WP_001085792.1.34512 WP_001085792.1.34526 WP_001085792.1.34531 WP_001085792.1.34569 WP_001085792.1.34578 WP_001085792.1.3461 WP_001085792.1.34620 WP_001085792.1.34677 WP_001085792.1.34716 WP_001085792.1.34723 WP_001085792.1.34733 WP_001085792.1.34737 WP_001085792.1.3474 WP_001085792.1.34741 WP_001085792.1.34767 WP_001085792.1.34774 WP_001085792.1.34818 WP_001085792.1.34847 WP_001085792.1.34865 WP_001085792.1.34877 WP_001085792.1.34890 WP_001085792.1.34912 WP_001085792.1.34918 WP_001085792.1.34923 WP_001085792.1.34926 WP_001085792.1.34943 WP_001085792.1.34967 WP_001085792.1.34970 WP_001085792.1.34998 WP_001085792.1.35014 WP_001085792.1.35029 WP_001085792.1.35031 WP_001085792.1.35032 WP_001085792.1.35054 WP_001085792.1.35059 WP_001085792.1.35062 WP_001085792.1.35089 WP_001085792.1.35097 WP_001085792.1.35110 WP_001085792.1.35121 WP_001085792.1.35182 WP_001085792.1.35183 WP_001085792.1.35194 WP_001085792.1.35233 WP_001085792.1.35243 WP_001085792.1.3526 WP_001085792.1.35264 WP_001085792.1.35276 WP_001085792.1.35285 WP_001085792.1.35289 WP_001085792.1.35297 WP_001085792.1.35307 WP_001085792.1.35314 WP_001085792.1.35334 WP_001085792.1.35340 WP_001085792.1.35342 WP_001085792.1.35345 WP_001085792.1.35391 WP_001085792.1.354 WP_001085792.1.35413 WP_001085792.1.35415 WP_001085792.1.3542 WP_001085792.1.35422 WP_001085792.1.35423 WP_001085792.1.35433 WP_001085792.1.35435 WP_001085792.1.3547 WP_001085792.1.3549 WP_001085792.1.35498 WP_001085792.1.35506 WP_001085792.1.35508 WP_001085792.1.35517 WP_001085792.1.35519 WP_001085792.1.35525 WP_001085792.1.35549 WP_001085792.1.35580 WP_001085792.1.35615 WP_001085792.1.35623 WP_001085792.1.35642 WP_001085792.1.35659 WP_001085792.1.35661 WP_001085792.1.35673 WP_001085792.1.35686 WP_001085792.1.3569 WP_001085792.1.35696 WP_001085792.1.35730 WP_001085792.1.3574 WP_001085792.1.35742 WP_001085792.1.35746 WP_001085792.1.35784 WP_001085792.1.3579 WP_001085792.1.35801 WP_001085792.1.35826 WP_001085792.1.35837 WP_001085792.1.35871 WP_001085792.1.35888 WP_001085792.1.35890 WP_001085792.1.35900 WP_001085792.1.35903 WP_001085792.1.35928 WP_001085792.1.35933 WP_001085792.1.35950 WP_001085792.1.35958 WP_001085792.1.35989 WP_001085792.1.36004 WP_001085792.1.36013 WP_001085792.1.36041 WP_001085792.1.36082 WP_001085792.1.36093 WP_001085792.1.36102 WP_001085792.1.3611 WP_001085792.1.36119 WP_001085792.1.36141 WP_001085792.1.3617 WP_001085792.1.36176 WP_001085792.1.36179 WP_001085792.1.36187 WP_001085792.1.36188 WP_001085792.1.36211 WP_001085792.1.36223 WP_001085792.1.36231 WP_001085792.1.36249 WP_001085792.1.36250 WP_001085792.1.36264 WP_001085792.1.36278 WP_001085792.1.36282 WP_001085792.1.36302 WP_001085792.1.36307 WP_001085792.1.36344 WP_001085792.1.36389 WP_001085792.1.36430 WP_001085792.1.36439 WP_001085792.1.36532 WP_001085792.1.36535 WP_001085792.1.3655 WP_001085792.1.36570 WP_001085792.1.36580 WP_001085792.1.3659 WP_001085792.1.36600 WP_001085792.1.36615 WP_001085792.1.36640 WP_001085792.1.36646 WP_001085792.1.3666 WP_001085792.1.36669 WP_001085792.1.36689 WP_001085792.1.36697 WP_001085792.1.36698 WP_001085792.1.36704 WP_001085792.1.36729 WP_001085792.1.36745 WP_001085792.1.3675 WP_001085792.1.36754 WP_001085792.1.36773 WP_001085792.1.36783 WP_001085792.1.36793 WP_001085792.1.36796 WP_001085792.1.36797 WP_001085792.1.36820 WP_001085792.1.36822 WP_001085792.1.36823 WP_001085792.1.36847 WP_001085792.1.3685 WP_001085792.1.36858 WP_001085792.1.36859 WP_001085792.1.3687 WP_001085792.1.36888 WP_001085792.1.3690 WP_001085792.1.36903 WP_001085792.1.36911 WP_001085792.1.36916 WP_001085792.1.36932 WP_001085792.1.36952 WP_001085792.1.36955 WP_001085792.1.36962 WP_001085792.1.36979 WP_001085792.1.36980 WP_001085792.1.36983 WP_001085792.1.36996 WP_001085792.1.36997 WP_001085792.1.37002 WP_001085792.1.37016 WP_001085792.1.3703 WP_001085792.1.37044 WP_001085792.1.37045 WP_001085792.1.37053 WP_001085792.1.37055 WP_001085792.1.37075 WP_001085792.1.37080 WP_001085792.1.3709 WP_001085792.1.37091 WP_001085792.1.37120 WP_001085792.1.37121 WP_001085792.1.37130 WP_001085792.1.37134 WP_001085792.1.37135 WP_001085792.1.37159 WP_001085792.1.3718 WP_001085792.1.37182 WP_001085792.1.3719 WP_001085792.1.3722 WP_001085792.1.37220 WP_001085792.1.37240 WP_001085792.1.37335 WP_001085792.1.37336 WP_001085792.1.37341 WP_001085792.1.37343 WP_001085792.1.37378 WP_001085792.1.37398 WP_001085792.1.37408 WP_001085792.1.37411 WP_001085792.1.37424 WP_001085792.1.37435 WP_001085792.1.37453 WP_001085792.1.37467 WP_001085792.1.37503 WP_001085792.1.37525 WP_001085792.1.37551 WP_001085792.1.37578 WP_001085792.1.37583 WP_001085792.1.37602 WP_001085792.1.37605 WP_001085792.1.37606 WP_001085792.1.37621 WP_001085792.1.37624 WP_001085792.1.37644 WP_001085792.1.37669 WP_001085792.1.37679 WP_001085792.1.37749 WP_001085792.1.3776 WP_001085792.1.37764 WP_001085792.1.37771 WP_001085792.1.37781 WP_001085792.1.37788 WP_001085792.1.37815 WP_001085792.1.37828 WP_001085792.1.37851 WP_001085792.1.37855 WP_001085792.1.37866 WP_001085792.1.37875 WP_001085792.1.37878 WP_001085792.1.37891 WP_001085792.1.37906 WP_001085792.1.37907 WP_001085792.1.37929 WP_001085792.1.37953 WP_001085792.1.37987 WP_001085792.1.38020 WP_001085792.1.38030 WP_001085792.1.38034 WP_001085792.1.38038 WP_001085792.1.38057 WP_001085792.1.38070 WP_001085792.1.38082 WP_001085792.1.3809 WP_001085792.1.38100 WP_001085792.1.38111 WP_001085792.1.38128 WP_001085792.1.3813 WP_001085792.1.38136 WP_001085792.1.38148 WP_001085792.1.38160 WP_001085792.1.3817 WP_001085792.1.38176 WP_001085792.1.38177 WP_001085792.1.3820 WP_001085792.1.38212 WP_001085792.1.38222 WP_001085792.1.38229 WP_001085792.1.38230 WP_001085792.1.38232 WP_001085792.1.38259 WP_001085792.1.38276 WP_001085792.1.38282 WP_001085792.1.38304 WP_001085792.1.38309 WP_001085792.1.38316 WP_001085792.1.38339 WP_001085792.1.38383 WP_001085792.1.38390 WP_001085792.1.3842 WP_001085792.1.38422 WP_001085792.1.38435 WP_001085792.1.38437 WP_001085792.1.38453 WP_001085792.1.38491 WP_001085792.1.38493 WP_001085792.1.38516 WP_001085792.1.38522 WP_001085792.1.38546 WP_001085792.1.38555 WP_001085792.1.38557 WP_001085792.1.38607 WP_001085792.1.38612 WP_001085792.1.38617 WP_001085792.1.38637 WP_001085792.1.38651 WP_001085792.1.38658 WP_001085792.1.38669 WP_001085792.1.3867 WP_001085792.1.38674 WP_001085792.1.38688 WP_001085792.1.38721 WP_001085792.1.38760 WP_001085792.1.38786 WP_001085792.1.38788 WP_001085792.1.38823 WP_001085792.1.38836 WP_001085792.1.38841 WP_001085792.1.38858 WP_001085792.1.38862 WP_001085792.1.38875 WP_001085792.1.38885 WP_001085792.1.38890 WP_001085792.1.38926 WP_001085792.1.38927 WP_001085792.1.38931 WP_001085792.1.38940 WP_001085792.1.38941 WP_001085792.1.38943 WP_001085792.1.38960 WP_001085792.1.38972 WP_001085792.1.38973 WP_001085792.1.38979 WP_001085792.1.38985 WP_001085792.1.38989 WP_001085792.1.390 WP_001085792.1.39012 WP_001085792.1.39014 WP_001085792.1.39017 WP_001085792.1.39026 WP_001085792.1.39043 WP_001085792.1.39053 WP_001085792.1.3906 WP_001085792.1.3908 WP_001085792.1.39080 WP_001085792.1.39089 WP_001085792.1.391 WP_001085792.1.39108 WP_001085792.1.39126 WP_001085792.1.39166 WP_001085792.1.39173 WP_001085792.1.39203 WP_001085792.1.39206 WP_001085792.1.39217 WP_001085792.1.39241 WP_001085792.1.3926 WP_001085792.1.39272 WP_001085792.1.39285 WP_001085792.1.39290 WP_001085792.1.39324 WP_001085792.1.39332 WP_001085792.1.39333 WP_001085792.1.39347 WP_001085792.1.39361 WP_001085792.1.39369 WP_001085792.1.39378 WP_001085792.1.39384 WP_001085792.1.39397 WP_001085792.1.39406 WP_001085792.1.39424 WP_001085792.1.39432 WP_001085792.1.39451 WP_001085792.1.39486 WP_001085792.1.39494 WP_001085792.1.39499 WP_001085792.1.39506 WP_001085792.1.39519 WP_001085792.1.39527 WP_001085792.1.39542 WP_001085792.1.39550 WP_001085792.1.39586 WP_001085792.1.39613 WP_001085792.1.39642 WP_001085792.1.39645 WP_001085792.1.39670 WP_001085792.1.39671 WP_001085792.1.39682 WP_001085792.1.39687 WP_001085792.1.39689 WP_001085792.1.39693 WP_001085792.1.39697 WP_001085792.1.39711 WP_001085792.1.39738 WP_001085792.1.39767 WP_001085792.1.39789 WP_001085792.1.39832 WP_001085792.1.39838 WP_001085792.1.39839 WP_001085792.1.39847 WP_001085792.1.39854 WP_001085792.1.39856 WP_001085792.1.39857 WP_001085792.1.39869 WP_001085792.1.39883 WP_001085792.1.39918 WP_001085792.1.39943 WP_001085792.1.40014 WP_001085792.1.40043 WP_001085792.1.40076 WP_001085792.1.40082 WP_001085792.1.40099 WP_001085792.1.4010 WP_001085792.1.40119 WP_001085792.1.40120 WP_001085792.1.40137 WP_001085792.1.40149 WP_001085792.1.4015 WP_001085792.1.40161 WP_001085792.1.40164 WP_001085792.1.40173 WP_001085792.1.4019 WP_001085792.1.40247 WP_001085792.1.40299 WP_001085792.1.40318 WP_001085792.1.40320 WP_001085792.1.40329 WP_001085792.1.40330 WP_001085792.1.40340 WP_001085792.1.40342 WP_001085792.1.40368 WP_001085792.1.40369 WP_001085792.1.40383 WP_001085792.1.40392 WP_001085792.1.40401 WP_001085792.1.40406 WP_001085792.1.40409 WP_001085792.1.40443 WP_001085792.1.4045 WP_001085792.1.40454 WP_001085792.1.40458 WP_001085792.1.40463 WP_001085792.1.40472 WP_001085792.1.40474 WP_001085792.1.40481 WP_001085792.1.40483 WP_001085792.1.40500 WP_001085792.1.40505 WP_001085792.1.40531 WP_001085792.1.40532 WP_001085792.1.40554 WP_001085792.1.4056 WP_001085792.1.40579 WP_001085792.1.40588 WP_001085792.1.40613 WP_001085792.1.40620 WP_001085792.1.40644 WP_001085792.1.40655 WP_001085792.1.40658 WP_001085792.1.40659 WP_001085792.1.40664 WP_001085792.1.40670 WP_001085792.1.40700 WP_001085792.1.40719 WP_001085792.1.40729 WP_001085792.1.40748 WP_001085792.1.40760 WP_001085792.1.4078 WP_001085792.1.40794 WP_001085792.1.40797 WP_001085792.1.40800 WP_001085792.1.40814 WP_001085792.1.40816 WP_001085792.1.40939 WP_001085792.1.41002 WP_001085792.1.41005 WP_001085792.1.41011 WP_001085792.1.4102 WP_001085792.1.41033 WP_001085792.1.41038 WP_001085792.1.4105 WP_001085792.1.41058 WP_001085792.1.41064 WP_001085792.1.41066 WP_001085792.1.41084 WP_001085792.1.41094 WP_001085792.1.41104 WP_001085792.1.41119 WP_001085792.1.41122 WP_001085792.1.41129 WP_001085792.1.41133 WP_001085792.1.4115 WP_001085792.1.41178 WP_001085792.1.412 WP_001085792.1.41208 WP_001085792.1.41241 WP_001085792.1.41255 WP_001085792.1.41289 WP_001085792.1.4129 WP_001085792.1.41341 WP_001085792.1.41350 WP_001085792.1.41374 WP_001085792.1.41386 WP_001085792.1.41389 WP_001085792.1.41411 WP_001085792.1.41426 WP_001085792.1.41432 WP_001085792.1.41433 WP_001085792.1.4144 WP_001085792.1.41448 WP_001085792.1.41456 WP_001085792.1.41458 WP_001085792.1.41473 WP_001085792.1.41499 WP_001085792.1.41511 WP_001085792.1.41532 WP_001085792.1.41533 WP_001085792.1.41537 WP_001085792.1.41555 WP_001085792.1.41558 WP_001085792.1.41567 WP_001085792.1.41581 WP_001085792.1.41582 WP_001085792.1.41587 WP_001085792.1.41597 WP_001085792.1.41598 WP_001085792.1.41620 WP_001085792.1.41623 WP_001085792.1.41647 WP_001085792.1.41674 WP_001085792.1.41679 WP_001085792.1.41681 WP_001085792.1.4169 WP_001085792.1.41698 WP_001085792.1.41726 WP_001085792.1.41743 WP_001085792.1.41755 WP_001085792.1.41770 WP_001085792.1.41805 WP_001085792.1.41817 WP_001085792.1.41819 WP_001085792.1.4182 WP_001085792.1.41821 WP_001085792.1.41839 WP_001085792.1.41863 WP_001085792.1.4188 WP_001085792.1.41891 WP_001085792.1.41898 WP_001085792.1.41915 WP_001085792.1.41935 WP_001085792.1.41943 WP_001085792.1.41954 WP_001085792.1.41972 WP_001085792.1.41983 WP_001085792.1.41989 WP_001085792.1.420 WP_001085792.1.42001 WP_001085792.1.42003 WP_001085792.1.42015 WP_001085792.1.42017 WP_001085792.1.4202 WP_001085792.1.42028 WP_001085792.1.42064 WP_001085792.1.42072 WP_001085792.1.42085 WP_001085792.1.42087 WP_001085792.1.42125 WP_001085792.1.42137 WP_001085792.1.42169 WP_001085792.1.42178 WP_001085792.1.42198 WP_001085792.1.42211 WP_001085792.1.42230 WP_001085792.1.42241 WP_001085792.1.4225 WP_001085792.1.42269 WP_001085792.1.42286 WP_001085792.1.42298 WP_001085792.1.42305 WP_001085792.1.42325 WP_001085792.1.42355 WP_001085792.1.42403 WP_001085792.1.42436 WP_001085792.1.42459 WP_001085792.1.42460 WP_001085792.1.42481 WP_001085792.1.42510 WP_001085792.1.42551 WP_001085792.1.42575 WP_001085792.1.42593 WP_001085792.1.426 WP_001085792.1.42607 WP_001085792.1.42640 WP_001085792.1.42652 WP_001085792.1.42667 WP_001085792.1.42668 WP_001085792.1.42679 WP_001085792.1.42681 WP_001085792.1.42733 WP_001085792.1.42737 WP_001085792.1.42738 WP_001085792.1.42740 WP_001085792.1.42759 WP_001085792.1.42786 WP_001085792.1.42798 WP_001085792.1.42816 WP_001085792.1.42819 WP_001085792.1.42837 WP_001085792.1.42848 WP_001085792.1.42883 WP_001085792.1.42897 WP_001085792.1.42907 WP_001085792.1.42924 WP_001085792.1.42925 WP_001085792.1.4293 WP_001085792.1.42959 WP_001085792.1.42984 WP_001085792.1.42985 WP_001085792.1.4299 WP_001085792.1.42990 WP_001085792.1.4300 WP_001085792.1.43014 WP_001085792.1.43020 WP_001085792.1.43023 WP_001085792.1.43042 WP_001085792.1.43047 WP_001085792.1.43072 WP_001085792.1.43095 WP_001085792.1.43110 WP_001085792.1.43114 WP_001085792.1.43122 WP_001085792.1.43125 WP_001085792.1.43131 WP_001085792.1.43134 WP_001085792.1.43139 WP_001085792.1.43143 WP_001085792.1.43147 WP_001085792.1.43159 WP_001085792.1.43165 WP_001085792.1.43168 WP_001085792.1.43184 WP_001085792.1.43200 WP_001085792.1.43202 WP_001085792.1.43204 WP_001085792.1.43206 WP_001085792.1.43220 WP_001085792.1.43232 WP_001085792.1.43248 WP_001085792.1.4325 WP_001085792.1.43252 WP_001085792.1.43263 WP_001085792.1.4327 WP_001085792.1.43274 WP_001085792.1.43279 WP_001085792.1.43323 WP_001085792.1.43331 WP_001085792.1.43341 WP_001085792.1.43349 WP_001085792.1.43360 WP_001085792.1.43369 WP_001085792.1.4337 WP_001085792.1.43375 WP_001085792.1.43383 WP_001085792.1.43405 WP_001085792.1.43406 WP_001085792.1.4341 WP_001085792.1.43410 WP_001085792.1.43414 WP_001085792.1.43446 WP_001085792.1.43460 WP_001085792.1.4347 WP_001085792.1.43506 WP_001085792.1.43512 WP_001085792.1.43530 WP_001085792.1.43550 WP_001085792.1.43560 WP_001085792.1.43573 WP_001085792.1.43594 WP_001085792.1.43617 WP_001085792.1.43618 WP_001085792.1.43627 WP_001085792.1.43659 WP_001085792.1.43665 WP_001085792.1.43670 WP_001085792.1.43683 WP_001085792.1.4369 WP_001085792.1.43693 WP_001085792.1.43702 WP_001085792.1.43703 WP_001085792.1.4372 WP_001085792.1.43731 WP_001085792.1.43752 WP_001085792.1.43784 WP_001085792.1.43788 WP_001085792.1.4379 WP_001085792.1.43800 WP_001085792.1.43819 WP_001085792.1.43827 WP_001085792.1.43842 WP_001085792.1.4385 WP_001085792.1.43851 WP_001085792.1.4386 WP_001085792.1.43904 WP_001085792.1.43915 WP_001085792.1.43964 WP_001085792.1.43984 WP_001085792.1.43988 WP_001085792.1.44021 WP_001085792.1.44074 WP_001085792.1.44095 WP_001085792.1.44119 WP_001085792.1.44150 WP_001085792.1.44153 WP_001085792.1.44177 WP_001085792.1.44178 WP_001085792.1.44181 WP_001085792.1.44186 WP_001085792.1.44195 WP_001085792.1.44255 WP_001085792.1.44265 WP_001085792.1.44302 WP_001085792.1.44331 WP_001085792.1.44344 WP_001085792.1.44382 WP_001085792.1.44388 WP_001085792.1.44396 WP_001085792.1.44405 WP_001085792.1.44420 WP_001085792.1.44432 WP_001085792.1.44480 WP_001085792.1.44504 WP_001085792.1.44515 WP_001085792.1.44517 WP_001085792.1.44520 WP_001085792.1.44536 WP_001085792.1.44544 WP_001085792.1.44547 WP_001085792.1.44579 WP_001085792.1.44586 WP_001085792.1.44588 WP_001085792.1.44605 WP_001085792.1.44623 WP_001085792.1.44631 WP_001085792.1.44646 WP_001085792.1.44655 WP_001085792.1.44667 WP_001085792.1.44672 WP_001085792.1.447 WP_001085792.1.44714 WP_001085792.1.44715 WP_001085792.1.44732 WP_001085792.1.44755 WP_001085792.1.44780 WP_001085792.1.44785 WP_001085792.1.44788 WP_001085792.1.44796 WP_001085792.1.44856 WP_001085792.1.44868 WP_001085792.1.44876 WP_001085792.1.44881 WP_001085792.1.44882 WP_001085792.1.44892 WP_001085792.1.44899 WP_001085792.1.44903 WP_001085792.1.44914 WP_001085792.1.44940 WP_001085792.1.44948 WP_001085792.1.44955 WP_001085792.1.44969 WP_001085792.1.4499 WP_001085792.1.44993 WP_001085792.1.45008 WP_001085792.1.45010 WP_001085792.1.45033 WP_001085792.1.45035 WP_001085792.1.45050 WP_001085792.1.45080 WP_001085792.1.45091 WP_001085792.1.45094 WP_001085792.1.45099 WP_001085792.1.45101 WP_001085792.1.45114 WP_001085792.1.4513 WP_001085792.1.45131 WP_001085792.1.45132 WP_001085792.1.45133 WP_001085792.1.45140 WP_001085792.1.45157 WP_001085792.1.45162 WP_001085792.1.45164 WP_001085792.1.45170 WP_001085792.1.452 WP_001085792.1.45218 WP_001085792.1.45221 WP_001085792.1.45223 WP_001085792.1.45242 WP_001085792.1.45267 WP_001085792.1.4527 WP_001085792.1.45272 WP_001085792.1.45281 WP_001085792.1.45290 WP_001085792.1.45297 WP_001085792.1.453 WP_001085792.1.45303 WP_001085792.1.45364 WP_001085792.1.45419 WP_001085792.1.45431 WP_001085792.1.45439 WP_001085792.1.45447 WP_001085792.1.4545 WP_001085792.1.45450 WP_001085792.1.45456 WP_001085792.1.4546 WP_001085792.1.45472 WP_001085792.1.4550 WP_001085792.1.45507 WP_001085792.1.45542 WP_001085792.1.45555 WP_001085792.1.45560 WP_001085792.1.45574 WP_001085792.1.45577 WP_001085792.1.45610 WP_001085792.1.45620 WP_001085792.1.45645 WP_001085792.1.45654 WP_001085792.1.45670 WP_001085792.1.45698 WP_001085792.1.45703 WP_001085792.1.45730 WP_001085792.1.45734 WP_001085792.1.45763 WP_001085792.1.45768 WP_001085792.1.4577 WP_001085792.1.45771 WP_001085792.1.45773 WP_001085792.1.45780 WP_001085792.1.4582 WP_001085792.1.45822 WP_001085792.1.45833 WP_001085792.1.4584 WP_001085792.1.45852 WP_001085792.1.45859 WP_001085792.1.45862 WP_001085792.1.45874 WP_001085792.1.45878 WP_001085792.1.45897 WP_001085792.1.45954 WP_001085792.1.4597 WP_001085792.1.45977 WP_001085792.1.4598 WP_001085792.1.46003 WP_001085792.1.46005 WP_001085792.1.46013 WP_001085792.1.46021 WP_001085792.1.46035 WP_001085792.1.46037 WP_001085792.1.46050 WP_001085792.1.46055 WP_001085792.1.46062 WP_001085792.1.46078 WP_001085792.1.46082 WP_001085792.1.46087 WP_001085792.1.46109 WP_001085792.1.46168 WP_001085792.1.46171 WP_001085792.1.46172 WP_001085792.1.46185 WP_001085792.1.46195 WP_001085792.1.46208 WP_001085792.1.46222 WP_001085792.1.46228 WP_001085792.1.46248 WP_001085792.1.46259 WP_001085792.1.46276 WP_001085792.1.46289 WP_001085792.1.46330 WP_001085792.1.46333 WP_001085792.1.46334 WP_001085792.1.46339 WP_001085792.1.46353 WP_001085792.1.46362 WP_001085792.1.46368 WP_001085792.1.46380 WP_001085792.1.46389 WP_001085792.1.46401 WP_001085792.1.46418 WP_001085792.1.46422 WP_001085792.1.46423 WP_001085792.1.46465 WP_001085792.1.46488 WP_001085792.1.46514 WP_001085792.1.46529 WP_001085792.1.46543 WP_001085792.1.46587 WP_001085792.1.46608 WP_001085792.1.46619 WP_001085792.1.4662 WP_001085792.1.46648 WP_001085792.1.46660 WP_001085792.1.46664 WP_001085792.1.46670 WP_001085792.1.46676 WP_001085792.1.46692 WP_001085792.1.46696 WP_001085792.1.46702 WP_001085792.1.46703 WP_001085792.1.46720 WP_001085792.1.46736 WP_001085792.1.46752 WP_001085792.1.46765 WP_001085792.1.46770 WP_001085792.1.46815 WP_001085792.1.46852 WP_001085792.1.46881 WP_001085792.1.46906 WP_001085792.1.46908 WP_001085792.1.46914 WP_001085792.1.46925 WP_001085792.1.46929 WP_001085792.1.46937 WP_001085792.1.4694 WP_001085792.1.46947 WP_001085792.1.4696 WP_001085792.1.46965 WP_001085792.1.46983 WP_001085792.1.46995 WP_001085792.1.47002 WP_001085792.1.47051 WP_001085792.1.47065 WP_001085792.1.47090 WP_001085792.1.47105 WP_001085792.1.47107 WP_001085792.1.47111 WP_001085792.1.47128 WP_001085792.1.47153 WP_001085792.1.47159 WP_001085792.1.47163 WP_001085792.1.47175 WP_001085792.1.47187 WP_001085792.1.47193 WP_001085792.1.47211 WP_001085792.1.47216 WP_001085792.1.47250 WP_001085792.1.47258 WP_001085792.1.47269 WP_001085792.1.47276 WP_001085792.1.47279 WP_001085792.1.4728 WP_001085792.1.47282 WP_001085792.1.47290 WP_001085792.1.47294 WP_001085792.1.47306 WP_001085792.1.47308 WP_001085792.1.47328 WP_001085792.1.47331 WP_001085792.1.47334 WP_001085792.1.47353 WP_001085792.1.47381 WP_001085792.1.47399 WP_001085792.1.47406 WP_001085792.1.47408 WP_001085792.1.47426 WP_001085792.1.47432 WP_001085792.1.47439 WP_001085792.1.47450 WP_001085792.1.47459 WP_001085792.1.47493 WP_001085792.1.47522 WP_001085792.1.47530 WP_001085792.1.47541 WP_001085792.1.47554 WP_001085792.1.47560 WP_001085792.1.47561 WP_001085792.1.47617 WP_001085792.1.47618 WP_001085792.1.47629 WP_001085792.1.47667 WP_001085792.1.47669 WP_001085792.1.4767 WP_001085792.1.47676 WP_001085792.1.47680 WP_001085792.1.477 WP_001085792.1.47702 WP_001085792.1.47719 WP_001085792.1.47733 WP_001085792.1.47747 WP_001085792.1.47763 WP_001085792.1.47782 WP_001085792.1.47807 WP_001085792.1.47835 WP_001085792.1.47836 WP_001085792.1.47851 WP_001085792.1.47859 WP_001085792.1.47864 WP_001085792.1.47872 WP_001085792.1.47873 WP_001085792.1.47888 WP_001085792.1.47904 WP_001085792.1.47908 WP_001085792.1.4792 WP_001085792.1.47989 WP_001085792.1.47996 WP_001085792.1.48011 WP_001085792.1.48013 WP_001085792.1.48017 WP_001085792.1.48030 WP_001085792.1.48046 WP_001085792.1.48047 WP_001085792.1.4805 WP_001085792.1.48057 WP_001085792.1.48067 WP_001085792.1.48116 WP_001085792.1.48142 WP_001085792.1.48149 WP_001085792.1.4815 WP_001085792.1.48154 WP_001085792.1.48156 WP_001085792.1.48169 WP_001085792.1.48186 WP_001085792.1.48187 WP_001085792.1.48199 WP_001085792.1.48212 WP_001085792.1.48223 WP_001085792.1.48227 WP_001085792.1.48236 WP_001085792.1.48250 WP_001085792.1.48272 WP_001085792.1.48282 WP_001085792.1.48284 WP_001085792.1.48293 WP_001085792.1.48307 WP_001085792.1.48310 WP_001085792.1.48322 WP_001085792.1.48327 WP_001085792.1.48335 WP_001085792.1.48376 WP_001085792.1.48391 WP_001085792.1.48394 WP_001085792.1.48398 WP_001085792.1.4840 WP_001085792.1.48425 WP_001085792.1.48427 WP_001085792.1.48437 WP_001085792.1.48438 WP_001085792.1.48463 WP_001085792.1.48479 WP_001085792.1.4852 WP_001085792.1.48556 WP_001085792.1.48563 WP_001085792.1.48577 WP_001085792.1.48580 WP_001085792.1.48593 WP_001085792.1.48601 WP_001085792.1.48634 WP_001085792.1.48655 WP_001085792.1.48656 WP_001085792.1.48670 WP_001085792.1.4868 WP_001085792.1.48705 WP_001085792.1.48711 WP_001085792.1.48769 WP_001085792.1.48775 WP_001085792.1.48782 WP_001085792.1.48805 WP_001085792.1.48817 WP_001085792.1.48818 WP_001085792.1.48823 WP_001085792.1.48833 WP_001085792.1.48835 WP_001085792.1.4886 WP_001085792.1.48869 WP_001085792.1.48936 WP_001085792.1.48941 WP_001085792.1.48943 WP_001085792.1.48945 WP_001085792.1.48951 WP_001085792.1.48966 WP_001085792.1.48968 WP_001085792.1.48982 WP_001085792.1.48993 WP_001085792.1.48996 WP_001085792.1.4901 WP_001085792.1.49018 WP_001085792.1.49032 WP_001085792.1.4905 WP_001085792.1.49071 WP_001085792.1.49094 WP_001085792.1.49105 WP_001085792.1.49128 WP_001085792.1.49129 WP_001085792.1.49143 WP_001085792.1.49154 WP_001085792.1.49159 WP_001085792.1.4916 WP_001085792.1.49161 WP_001085792.1.49168 WP_001085792.1.4917 WP_001085792.1.49171 WP_001085792.1.49173 WP_001085792.1.4918 WP_001085792.1.49189 WP_001085792.1.49196 WP_001085792.1.49199 WP_001085792.1.4920 WP_001085792.1.49207 WP_001085792.1.49227 WP_001085792.1.49234 WP_001085792.1.4924 WP_001085792.1.49248 WP_001085792.1.49257 WP_001085792.1.49269 WP_001085792.1.49301 WP_001085792.1.49326 WP_001085792.1.49327 WP_001085792.1.49329 WP_001085792.1.49330 WP_001085792.1.49362 WP_001085792.1.49367 WP_001085792.1.49373 WP_001085792.1.49398 WP_001085792.1.49418 WP_001085792.1.49444 WP_001085792.1.49479 WP_001085792.1.4950 WP_001085792.1.49518 WP_001085792.1.49530 WP_001085792.1.49539 WP_001085792.1.49549 WP_001085792.1.49581 WP_001085792.1.49582 WP_001085792.1.496 WP_001085792.1.49603 WP_001085792.1.4962 WP_001085792.1.49643 WP_001085792.1.49653 WP_001085792.1.49669 WP_001085792.1.49672 WP_001085792.1.49690 WP_001085792.1.49704 WP_001085792.1.49715 WP_001085792.1.49728 WP_001085792.1.49730 WP_001085792.1.49732 WP_001085792.1.49742 WP_001085792.1.49745 WP_001085792.1.4980 WP_001085792.1.49800 WP_001085792.1.49819 WP_001085792.1.4982 WP_001085792.1.49825 WP_001085792.1.4984 WP_001085792.1.49860 WP_001085792.1.49863 WP_001085792.1.49871 WP_001085792.1.4989 WP_001085792.1.49894 WP_001085792.1.49907 WP_001085792.1.49912 WP_001085792.1.49913 WP_001085792.1.49918 WP_001085792.1.49921 WP_001085792.1.49934 WP_001085792.1.49935 WP_001085792.1.49936 WP_001085792.1.4994 WP_001085792.1.49970 WP_001085792.1.49982 WP_001085792.1.50013 WP_001085792.1.50015 WP_001085792.1.50028 WP_001085792.1.50038 WP_001085792.1.50039 WP_001085792.1.50061 WP_001085792.1.50071 WP_001085792.1.50076 WP_001085792.1.50117 WP_001085792.1.5013 WP_001085792.1.50138 WP_001085792.1.50145 WP_001085792.1.50178 WP_001085792.1.50192 WP_001085792.1.50217 WP_001085792.1.50219 WP_001085792.1.50229 WP_001085792.1.50261 WP_001085792.1.50313 WP_001085792.1.50314 WP_001085792.1.50356 WP_001085792.1.50360 WP_001085792.1.50367 WP_001085792.1.50369 WP_001085792.1.50377 WP_001085792.1.50388 WP_001085792.1.50425 WP_001085792.1.50430 WP_001085792.1.50431 WP_001085792.1.5045 WP_001085792.1.50462 WP_001085792.1.50464 WP_001085792.1.50477 WP_001085792.1.50516 WP_001085792.1.50525 WP_001085792.1.50536 WP_001085792.1.50555 WP_001085792.1.50556 WP_001085792.1.50558 WP_001085792.1.50568 WP_001085792.1.50578 WP_001085792.1.5059 WP_001085792.1.50594 WP_001085792.1.50595 WP_001085792.1.50647 WP_001085792.1.50660 WP_001085792.1.50669 WP_001085792.1.50699 WP_001085792.1.50711 WP_001085792.1.50740 WP_001085792.1.50745 WP_001085792.1.50759 WP_001085792.1.50768 WP_001085792.1.50799 WP_001085792.1.5080 WP_001085792.1.50817 WP_001085792.1.50820 WP_001085792.1.50827 WP_001085792.1.50829 WP_001085792.1.5087 WP_001085792.1.50884 WP_001085792.1.50896 WP_001085792.1.50937 WP_001085792.1.50962 WP_001085792.1.50974 WP_001085792.1.51008 WP_001085792.1.51015 WP_001085792.1.51031 WP_001085792.1.51062 WP_001085792.1.5108 WP_001085792.1.51085 WP_001085792.1.5109 WP_001085792.1.5110 WP_001085792.1.5111 WP_001085792.1.51130 WP_001085792.1.51133 WP_001085792.1.51138 WP_001085792.1.51152 WP_001085792.1.51209 WP_001085792.1.51220 WP_001085792.1.51226 WP_001085792.1.51236 WP_001085792.1.51245 WP_001085792.1.51250 WP_001085792.1.51277 WP_001085792.1.51282 WP_001085792.1.51295 WP_001085792.1.51306 WP_001085792.1.51310 WP_001085792.1.51326 WP_001085792.1.51346 WP_001085792.1.51365 WP_001085792.1.51376 WP_001085792.1.51393 WP_001085792.1.51403 WP_001085792.1.51454 WP_001085792.1.51456 WP_001085792.1.51465 WP_001085792.1.51492 WP_001085792.1.51496 WP_001085792.1.515 WP_001085792.1.51527 WP_001085792.1.5155 WP_001085792.1.51557 WP_001085792.1.51558 WP_001085792.1.51559 WP_001085792.1.51575 WP_001085792.1.51590 WP_001085792.1.51665 WP_001085792.1.51672 WP_001085792.1.51716 WP_001085792.1.51741 WP_001085792.1.51744 WP_001085792.1.51748 WP_001085792.1.51787 WP_001085792.1.51794 WP_001085792.1.51797 WP_001085792.1.51812 WP_001085792.1.51824 WP_001085792.1.51836 WP_001085792.1.51842 WP_001085792.1.51844 WP_001085792.1.5186 WP_001085792.1.51871 WP_001085792.1.51883 WP_001085792.1.5190 WP_001085792.1.51912 WP_001085792.1.51920 WP_001085792.1.51924 WP_001085792.1.51936 WP_001085792.1.51952 WP_001085792.1.51971 WP_001085792.1.51973 WP_001085792.1.51995 WP_001085792.1.52034 WP_001085792.1.52061 WP_001085792.1.52072 WP_001085792.1.52078 WP_001085792.1.5209 WP_001085792.1.521 WP_001085792.1.5213 WP_001085792.1.52151 WP_001085792.1.52162 WP_001085792.1.52182 WP_001085792.1.52185 WP_001085792.1.52193 WP_001085792.1.52195 WP_001085792.1.52198 WP_001085792.1.52210 WP_001085792.1.52251 WP_001085792.1.52252 WP_001085792.1.52259 WP_001085792.1.5228 WP_001085792.1.52289 WP_001085792.1.52296 WP_001085792.1.523 WP_001085792.1.52308 WP_001085792.1.5231 WP_001085792.1.52322 WP_001085792.1.52327 WP_001085792.1.52331 WP_001085792.1.52340 WP_001085792.1.52343 WP_001085792.1.52377 WP_001085792.1.52396 WP_001085792.1.52423 WP_001085792.1.52427 WP_001085792.1.52436 WP_001085792.1.52440 WP_001085792.1.52442 WP_001085792.1.52452 WP_001085792.1.52463 WP_001085792.1.5251 WP_001085792.1.52511 WP_001085792.1.52518 WP_001085792.1.52536 WP_001085792.1.52548 WP_001085792.1.52595 WP_001085792.1.52605 WP_001085792.1.52623 WP_001085792.1.52624 WP_001085792.1.52633 WP_001085792.1.52645 WP_001085792.1.52670 WP_001085792.1.52687 WP_001085792.1.52699 WP_001085792.1.52715 WP_001085792.1.52722 WP_001085792.1.52751 WP_001085792.1.52754 WP_001085792.1.52772 WP_001085792.1.52820 WP_001085792.1.52830 WP_001085792.1.52836 WP_001085792.1.52838 WP_001085792.1.52848 WP_001085792.1.52865 WP_001085792.1.52877 WP_001085792.1.52878 WP_001085792.1.52886 WP_001085792.1.52889 WP_001085792.1.52893 WP_001085792.1.52900 WP_001085792.1.52904 WP_001085792.1.52941 WP_001085792.1.52947 WP_001085792.1.52965 WP_001085792.1.52983 WP_001085792.1.52984 WP_001085792.1.53002 WP_001085792.1.53007 WP_001085792.1.5304 WP_001085792.1.53050 WP_001085792.1.53057 WP_001085792.1.53071 WP_001085792.1.53077 WP_001085792.1.53094 WP_001085792.1.53140 WP_001085792.1.53153 WP_001085792.1.53178 WP_001085792.1.53189 WP_001085792.1.5319 WP_001085792.1.53209 WP_001085792.1.5321 WP_001085792.1.5323 WP_001085792.1.53245 WP_001085792.1.53260 WP_001085792.1.53285 WP_001085792.1.53312 WP_001085792.1.53317 WP_001085792.1.53319 WP_001085792.1.53323 WP_001085792.1.53352 WP_001085792.1.53363 WP_001085792.1.53372 WP_001085792.1.53373 WP_001085792.1.53379 WP_001085792.1.53387 WP_001085792.1.53394 WP_001085792.1.53403 WP_001085792.1.53408 WP_001085792.1.53418 WP_001085792.1.53432 WP_001085792.1.53433 WP_001085792.1.53452 WP_001085792.1.53462 WP_001085792.1.53467 WP_001085792.1.53488 WP_001085792.1.53503 WP_001085792.1.53521 WP_001085792.1.53532 WP_001085792.1.53577 WP_001085792.1.5359 WP_001085792.1.53641 WP_001085792.1.53648 WP_001085792.1.53661 WP_001085792.1.53671 WP_001085792.1.53682 WP_001085792.1.53691 WP_001085792.1.53712 WP_001085792.1.53714 WP_001085792.1.53759 WP_001085792.1.53763 WP_001085792.1.53766 WP_001085792.1.53774 WP_001085792.1.53786 WP_001085792.1.53799 WP_001085792.1.53827 WP_001085792.1.53835 WP_001085792.1.53886 WP_001085792.1.53889 WP_001085792.1.53911 WP_001085792.1.53915 WP_001085792.1.53926 WP_001085792.1.53934 WP_001085792.1.53969 WP_001085792.1.53999 WP_001085792.1.5401 WP_001085792.1.54022 WP_001085792.1.54029 WP_001085792.1.54048 WP_001085792.1.54049 WP_001085792.1.54074 WP_001085792.1.54086 WP_001085792.1.54105 WP_001085792.1.54109 WP_001085792.1.54135 WP_001085792.1.54147 WP_001085792.1.54161 WP_001085792.1.54229 WP_001085792.1.54237 WP_001085792.1.54246 WP_001085792.1.54253 WP_001085792.1.54269 WP_001085792.1.54290 WP_001085792.1.54297 WP_001085792.1.54299 WP_001085792.1.54373 WP_001085792.1.54395 WP_001085792.1.544 WP_001085792.1.54404 WP_001085792.1.54413 WP_001085792.1.54446 WP_001085792.1.54471 WP_001085792.1.54477 WP_001085792.1.54479 WP_001085792.1.54485 WP_001085792.1.54491 WP_001085792.1.54503 WP_001085792.1.54510 WP_001085792.1.54543 WP_001085792.1.54551 WP_001085792.1.54554 WP_001085792.1.54574 WP_001085792.1.54637 WP_001085792.1.54675 WP_001085792.1.54689 WP_001085792.1.5469 WP_001085792.1.54744 WP_001085792.1.54745 WP_001085792.1.54753 WP_001085792.1.54806 WP_001085792.1.54847 WP_001085792.1.54878 WP_001085792.1.54895 WP_001085792.1.54914 WP_001085792.1.54929 WP_001085792.1.54931 WP_001085792.1.54955 WP_001085792.1.54967 WP_001085792.1.54990 WP_001085792.1.5500 WP_001085792.1.55014 WP_001085792.1.55058 WP_001085792.1.55082 WP_001085792.1.55084 WP_001085792.1.55090 WP_001085792.1.55095 WP_001085792.1.55139 WP_001085792.1.5518 WP_001085792.1.5519 WP_001085792.1.552 WP_001085792.1.55214 WP_001085792.1.55239 WP_001085792.1.55271 WP_001085792.1.55272 WP_001085792.1.55274 WP_001085792.1.55309 WP_001085792.1.55336 WP_001085792.1.55352 WP_001085792.1.5536 WP_001085792.1.55367 WP_001085792.1.55369 WP_001085792.1.55403 WP_001085792.1.55405 WP_001085792.1.55419 WP_001085792.1.55421 WP_001085792.1.55495 WP_001085792.1.5550 WP_001085792.1.55508 WP_001085792.1.55527 WP_001085792.1.55535 WP_001085792.1.5554 WP_001085792.1.55544 WP_001085792.1.55558 WP_001085792.1.5556 WP_001085792.1.55583 WP_001085792.1.5559 WP_001085792.1.55603 WP_001085792.1.5562 WP_001085792.1.55620 WP_001085792.1.55628 WP_001085792.1.55637 WP_001085792.1.5565 WP_001085792.1.55653 WP_001085792.1.55657 WP_001085792.1.557 WP_001085792.1.55717 WP_001085792.1.55719 WP_001085792.1.55728 WP_001085792.1.5575 WP_001085792.1.55784 WP_001085792.1.55786 WP_001085792.1.5580 WP_001085792.1.55818 WP_001085792.1.55831 WP_001085792.1.55835 WP_001085792.1.55839 WP_001085792.1.55845 WP_001085792.1.55848 WP_001085792.1.55859 WP_001085792.1.55867 WP_001085792.1.55874 WP_001085792.1.55886 WP_001085792.1.5589 WP_001085792.1.55904 WP_001085792.1.55916 WP_001085792.1.55933 WP_001085792.1.55941 WP_001085792.1.55949 WP_001085792.1.55953 WP_001085792.1.55955 WP_001085792.1.55960 WP_001085792.1.55985 WP_001085792.1.55991 WP_001085792.1.56000 WP_001085792.1.56003 WP_001085792.1.56025 WP_001085792.1.5604 WP_001085792.1.56048 WP_001085792.1.5606 WP_001085792.1.56064 WP_001085792.1.56078 WP_001085792.1.56098 WP_001085792.1.56099 WP_001085792.1.56106 WP_001085792.1.56135 WP_001085792.1.56159 WP_001085792.1.56200 WP_001085792.1.56210 WP_001085792.1.56213 WP_001085792.1.56220 WP_001085792.1.56225 WP_001085792.1.5623 WP_001085792.1.56237 WP_001085792.1.56239 WP_001085792.1.56241 WP_001085792.1.56242 WP_001085792.1.56260 WP_001085792.1.56272 WP_001085792.1.56275 WP_001085792.1.56281 WP_001085792.1.56306 WP_001085792.1.56332 WP_001085792.1.56333 WP_001085792.1.5635 WP_001085792.1.56364 WP_001085792.1.56377 WP_001085792.1.56387 WP_001085792.1.56400 WP_001085792.1.5644 WP_001085792.1.56444 WP_001085792.1.56464 WP_001085792.1.56482 WP_001085792.1.56522 WP_001085792.1.56525 WP_001085792.1.56527 WP_001085792.1.56530 WP_001085792.1.56542 WP_001085792.1.56558 WP_001085792.1.5658 WP_001085792.1.56584 WP_001085792.1.56598 WP_001085792.1.566 WP_001085792.1.56608 WP_001085792.1.56619 WP_001085792.1.56628 WP_001085792.1.56641 WP_001085792.1.56658 WP_001085792.1.5666 WP_001085792.1.56679 WP_001085792.1.56696 WP_001085792.1.56702 WP_001085792.1.56708 WP_001085792.1.56722 WP_001085792.1.5675 WP_001085792.1.56767 WP_001085792.1.5677 WP_001085792.1.56772 WP_001085792.1.56778 WP_001085792.1.56794 WP_001085792.1.56803 WP_001085792.1.56815 WP_001085792.1.56822 WP_001085792.1.56856 WP_001085792.1.5686 WP_001085792.1.56865 WP_001085792.1.56878 WP_001085792.1.569 WP_001085792.1.56903 WP_001085792.1.56931 WP_001085792.1.56966 WP_001085792.1.56967 WP_001085792.1.56975 WP_001085792.1.56986 WP_001085792.1.57015 WP_001085792.1.57024 WP_001085792.1.57047 WP_001085792.1.5705 WP_001085792.1.57073 WP_001085792.1.57075 WP_001085792.1.57080 WP_001085792.1.57081 WP_001085792.1.57097 WP_001085792.1.57102 WP_001085792.1.57109 WP_001085792.1.57115 WP_001085792.1.57141 WP_001085792.1.57158 WP_001085792.1.57170 WP_001085792.1.5718 WP_001085792.1.57190 WP_001085792.1.57196 WP_001085792.1.57214 WP_001085792.1.57265 WP_001085792.1.57271 WP_001085792.1.57291 WP_001085792.1.57309 WP_001085792.1.57330 WP_001085792.1.57338 WP_001085792.1.5735 WP_001085792.1.57385 WP_001085792.1.57389 WP_001085792.1.57427 WP_001085792.1.5743 WP_001085792.1.57445 WP_001085792.1.57448 WP_001085792.1.57459 WP_001085792.1.57481 WP_001085792.1.5749 WP_001085792.1.57537 WP_001085792.1.57577 WP_001085792.1.57593 WP_001085792.1.57594 WP_001085792.1.57612 WP_001085792.1.57614 WP_001085792.1.57635 WP_001085792.1.57650 WP_001085792.1.57665 WP_001085792.1.57670 WP_001085792.1.57682 WP_001085792.1.57692 WP_001085792.1.57693 WP_001085792.1.57701 WP_001085792.1.57718 WP_001085792.1.57723 WP_001085792.1.57727 WP_001085792.1.57730 WP_001085792.1.57734 WP_001085792.1.57754 WP_001085792.1.57783 WP_001085792.1.57786 WP_001085792.1.57808 WP_001085792.1.57819 WP_001085792.1.57837 WP_001085792.1.57840 WP_001085792.1.57844 WP_001085792.1.57861 WP_001085792.1.57875 WP_001085792.1.57878 WP_001085792.1.57883 WP_001085792.1.5791 WP_001085792.1.57928 WP_001085792.1.57943 WP_001085792.1.57952 WP_001085792.1.57962 WP_001085792.1.57974 WP_001085792.1.5799 WP_001085792.1.58006 WP_001085792.1.58016 WP_001085792.1.58035 WP_001085792.1.58042 WP_001085792.1.58049 WP_001085792.1.58051 WP_001085792.1.58074 WP_001085792.1.58116 WP_001085792.1.58122 WP_001085792.1.58127 WP_001085792.1.58139 WP_001085792.1.58148 WP_001085792.1.58158 WP_001085792.1.5816 WP_001085792.1.5817 WP_001085792.1.58185 WP_001085792.1.58198 WP_001085792.1.58212 WP_001085792.1.58241 WP_001085792.1.58242 WP_001085792.1.58246 WP_001085792.1.5827 WP_001085792.1.58277 WP_001085792.1.58317 WP_001085792.1.5832 WP_001085792.1.58321 WP_001085792.1.58325 WP_001085792.1.58350 WP_001085792.1.58352 WP_001085792.1.58353 WP_001085792.1.58364 WP_001085792.1.58366 WP_001085792.1.58373 WP_001085792.1.58392 WP_001085792.1.58395 WP_001085792.1.58419 WP_001085792.1.58430 WP_001085792.1.58435 WP_001085792.1.58481 WP_001085792.1.5849 WP_001085792.1.58495 WP_001085792.1.58497 WP_001085792.1.58504 WP_001085792.1.58508 WP_001085792.1.58512 WP_001085792.1.58521 WP_001085792.1.58530 WP_001085792.1.58538 WP_001085792.1.5857 WP_001085792.1.58571 WP_001085792.1.58584 WP_001085792.1.58588 WP_001085792.1.58592 WP_001085792.1.58598 WP_001085792.1.586 WP_001085792.1.58603 WP_001085792.1.58626 WP_001085792.1.58686 WP_001085792.1.58704 WP_001085792.1.58714 WP_001085792.1.58718 WP_001085792.1.58735 WP_001085792.1.58760 WP_001085792.1.58763 WP_001085792.1.58772 WP_001085792.1.58775 WP_001085792.1.5880 WP_001085792.1.58833 WP_001085792.1.58839 WP_001085792.1.58855 WP_001085792.1.58860 WP_001085792.1.58934 WP_001085792.1.58936 WP_001085792.1.58960 WP_001085792.1.58981 WP_001085792.1.5901 WP_001085792.1.59011 WP_001085792.1.59014 WP_001085792.1.59039 WP_001085792.1.5904 WP_001085792.1.59046 WP_001085792.1.59062 WP_001085792.1.59077 WP_001085792.1.59098 WP_001085792.1.59124 WP_001085792.1.59133 WP_001085792.1.59146 WP_001085792.1.59157 WP_001085792.1.59175 WP_001085792.1.59178 WP_001085792.1.59187 WP_001085792.1.5920 WP_001085792.1.5925 WP_001085792.1.59269 WP_001085792.1.59284 WP_001085792.1.59311 WP_001085792.1.59327 WP_001085792.1.59329 WP_001085792.1.59334 WP_001085792.1.59337 WP_001085792.1.59363 WP_001085792.1.5938 WP_001085792.1.59380 WP_001085792.1.59398 WP_001085792.1.5940 WP_001085792.1.59404 WP_001085792.1.59414 WP_001085792.1.59457 WP_001085792.1.59459 WP_001085792.1.59462 WP_001085792.1.59464 WP_001085792.1.59467 WP_001085792.1.59478 WP_001085792.1.59489 WP_001085792.1.59498 WP_001085792.1.59540 WP_001085792.1.59546 WP_001085792.1.59547 WP_001085792.1.59567 WP_001085792.1.59594 WP_001085792.1.59598 WP_001085792.1.59603 WP_001085792.1.59609 WP_001085792.1.59624 WP_001085792.1.59629 WP_001085792.1.59643 WP_001085792.1.59663 WP_001085792.1.59668 WP_001085792.1.59669 WP_001085792.1.59671 WP_001085792.1.59697 WP_001085792.1.5972 WP_001085792.1.59736 WP_001085792.1.59787 WP_001085792.1.59803 WP_001085792.1.59810 WP_001085792.1.5982 WP_001085792.1.59822 WP_001085792.1.59864 WP_001085792.1.59874 WP_001085792.1.59886 WP_001085792.1.59907 WP_001085792.1.59915 WP_001085792.1.59921 WP_001085792.1.59945 WP_001085792.1.59977 WP_001085792.1.60006 WP_001085792.1.60086 WP_001085792.1.60101 WP_001085792.1.6011 WP_001085792.1.60118 WP_001085792.1.60123 WP_001085792.1.60147 WP_001085792.1.60149 WP_001085792.1.60157 WP_001085792.1.60158 WP_001085792.1.60165 WP_001085792.1.6017 WP_001085792.1.60181 WP_001085792.1.602 WP_001085792.1.60201 WP_001085792.1.60227 WP_001085792.1.60251 WP_001085792.1.60259 WP_001085792.1.60280 WP_001085792.1.60289 WP_001085792.1.60302 WP_001085792.1.60307 WP_001085792.1.60339 WP_001085792.1.60345 WP_001085792.1.60353 WP_001085792.1.60355 WP_001085792.1.60360 WP_001085792.1.60368 WP_001085792.1.60431 WP_001085792.1.60434 WP_001085792.1.6045 WP_001085792.1.60462 WP_001085792.1.60489 WP_001085792.1.60492 WP_001085792.1.60515 WP_001085792.1.60547 WP_001085792.1.60551 WP_001085792.1.60585 WP_001085792.1.60594 WP_001085792.1.60595 WP_001085792.1.60636 WP_001085792.1.60641 WP_001085792.1.60690 WP_001085792.1.60696 WP_001085792.1.60704 WP_001085792.1.60719 WP_001085792.1.60730 WP_001085792.1.60734 WP_001085792.1.60742 WP_001085792.1.60750 WP_001085792.1.60751 WP_001085792.1.60758 WP_001085792.1.60759 WP_001085792.1.60765 WP_001085792.1.60778 WP_001085792.1.60787 WP_001085792.1.60813 WP_001085792.1.60820 WP_001085792.1.60845 WP_001085792.1.6085 WP_001085792.1.60859 WP_001085792.1.60869 WP_001085792.1.60888 WP_001085792.1.60898 WP_001085792.1.60912 WP_001085792.1.60917 WP_001085792.1.60923 WP_001085792.1.60934 WP_001085792.1.60939 WP_001085792.1.60946 WP_001085792.1.60948 WP_001085792.1.60965 WP_001085792.1.60981 WP_001085792.1.60982 WP_001085792.1.60991 WP_001085792.1.61009 WP_001085792.1.61013 WP_001085792.1.61019 WP_001085792.1.61023 WP_001085792.1.61026 WP_001085792.1.61029 WP_001085792.1.61030 WP_001085792.1.61031 WP_001085792.1.61082 WP_001085792.1.61107 WP_001085792.1.61115 WP_001085792.1.61119 WP_001085792.1.61139 WP_001085792.1.61152 WP_001085792.1.61153 WP_001085792.1.61188 WP_001085792.1.61189 WP_001085792.1.6119 WP_001085792.1.61224 WP_001085792.1.6123 WP_001085792.1.61257 WP_001085792.1.61263 WP_001085792.1.61271 WP_001085792.1.61286 WP_001085792.1.61289 WP_001085792.1.61313 WP_001085792.1.61316 WP_001085792.1.61318 WP_001085792.1.61324 WP_001085792.1.61327 WP_001085792.1.61339 WP_001085792.1.61346 WP_001085792.1.61353 WP_001085792.1.61354 WP_001085792.1.6136 WP_001085792.1.61375 WP_001085792.1.61394 WP_001085792.1.61408 WP_001085792.1.61413 WP_001085792.1.61430 WP_001085792.1.61439 WP_001085792.1.61440 WP_001085792.1.6149 WP_001085792.1.61515 WP_001085792.1.61534 WP_001085792.1.61547 WP_001085792.1.61555 WP_001085792.1.61585 WP_001085792.1.61591 WP_001085792.1.61597 WP_001085792.1.61615 WP_001085792.1.61639 WP_001085792.1.61653 WP_001085792.1.6166 WP_001085792.1.6168 WP_001085792.1.61705 WP_001085792.1.61709 WP_001085792.1.61713 WP_001085792.1.61749 WP_001085792.1.61776 WP_001085792.1.61784 WP_001085792.1.61800 WP_001085792.1.61802 WP_001085792.1.61831 WP_001085792.1.61838 WP_001085792.1.61843 WP_001085792.1.6188 WP_001085792.1.61897 WP_001085792.1.61899 WP_001085792.1.61903 WP_001085792.1.61910 WP_001085792.1.61936 WP_001085792.1.61962 WP_001085792.1.61970 WP_001085792.1.61976 WP_001085792.1.61978 WP_001085792.1.62002 WP_001085792.1.6201 WP_001085792.1.62028 WP_001085792.1.62030 WP_001085792.1.62069 WP_001085792.1.62071 WP_001085792.1.6208 WP_001085792.1.62084 WP_001085792.1.62085 WP_001085792.1.62088 WP_001085792.1.62093 WP_001085792.1.62096 WP_001085792.1.62127 WP_001085792.1.62140 WP_001085792.1.62164 WP_001085792.1.62247 WP_001085792.1.62253 WP_001085792.1.62254 WP_001085792.1.62318 WP_001085792.1.6234 WP_001085792.1.62346 WP_001085792.1.62352 WP_001085792.1.62367 WP_001085792.1.62382 WP_001085792.1.62392 WP_001085792.1.62398 WP_001085792.1.62409 WP_001085792.1.62416 WP_001085792.1.62429 WP_001085792.1.62437 WP_001085792.1.62453 WP_001085792.1.62459 WP_001085792.1.62462 WP_001085792.1.62474 WP_001085792.1.62496 WP_001085792.1.6250 WP_001085792.1.62537 WP_001085792.1.62539 WP_001085792.1.62553 WP_001085792.1.62563 WP_001085792.1.62575 WP_001085792.1.62602 WP_001085792.1.62608 WP_001085792.1.62621 WP_001085792.1.62625 WP_001085792.1.62630 WP_001085792.1.62653 WP_001085792.1.6266 WP_001085792.1.62671 WP_001085792.1.62674 WP_001085792.1.6268 WP_001085792.1.62684 WP_001085792.1.62685 WP_001085792.1.62723 WP_001085792.1.62740 WP_001085792.1.62764 WP_001085792.1.62771 WP_001085792.1.62781 WP_001085792.1.62796 WP_001085792.1.62808 WP_001085792.1.62822 WP_001085792.1.62829 WP_001085792.1.62831 WP_001085792.1.62842 WP_001085792.1.62860 WP_001085792.1.62863 WP_001085792.1.62878 WP_001085792.1.62880 WP_001085792.1.62925 WP_001085792.1.62956 WP_001085792.1.62970 WP_001085792.1.63003 WP_001085792.1.63004 WP_001085792.1.63011 WP_001085792.1.63021 WP_001085792.1.63027 WP_001085792.1.63040 WP_001085792.1.63047 WP_001085792.1.63050 WP_001085792.1.63051 WP_001085792.1.63052 WP_001085792.1.63068 WP_001085792.1.63070 WP_001085792.1.63083 WP_001085792.1.631 WP_001085792.1.63107 WP_001085792.1.63120 WP_001085792.1.63131 WP_001085792.1.63132 WP_001085792.1.63139 WP_001085792.1.63140 WP_001085792.1.63143 WP_001085792.1.63170 WP_001085792.1.63182 WP_001085792.1.63190 WP_001085792.1.63195 WP_001085792.1.63215 WP_001085792.1.63220 WP_001085792.1.63228 WP_001085792.1.63233 WP_001085792.1.63244 WP_001085792.1.63255 WP_001085792.1.63266 WP_001085792.1.63273 WP_001085792.1.63279 WP_001085792.1.63288 WP_001085792.1.63289 WP_001085792.1.63296 WP_001085792.1.63304 WP_001085792.1.63307 WP_001085792.1.63313 WP_001085792.1.63322 WP_001085792.1.63324 WP_001085792.1.63333 WP_001085792.1.63335 WP_001085792.1.63337 WP_001085792.1.63341 WP_001085792.1.634 WP_001085792.1.63406 WP_001085792.1.63411 WP_001085792.1.63421 WP_001085792.1.63441 WP_001085792.1.63469 WP_001085792.1.63471 WP_001085792.1.63510 WP_001085792.1.63527 WP_001085792.1.63540 WP_001085792.1.6355 WP_001085792.1.63565 WP_001085792.1.63589 WP_001085792.1.63617 WP_001085792.1.63635 WP_001085792.1.63672 WP_001085792.1.63673 WP_001085792.1.63678 WP_001085792.1.63693 WP_001085792.1.63704 WP_001085792.1.63705 WP_001085792.1.63726 WP_001085792.1.63729 WP_001085792.1.63751 WP_001085792.1.63759 WP_001085792.1.63763 WP_001085792.1.63774 WP_001085792.1.6378 WP_001085792.1.63828 WP_001085792.1.63847 WP_001085792.1.6387 WP_001085792.1.63874 WP_001085792.1.6388 WP_001085792.1.63890 WP_001085792.1.63894 WP_001085792.1.63895 WP_001085792.1.63907 WP_001085792.1.63910 WP_001085792.1.63923 WP_001085792.1.63947 WP_001085792.1.63975 WP_001085792.1.63978 WP_001085792.1.63998 WP_001085792.1.64012 WP_001085792.1.6403 WP_001085792.1.64060 WP_001085792.1.64079 WP_001085792.1.6408 WP_001085792.1.64094 WP_001085792.1.64105 WP_001085792.1.64108 WP_001085792.1.64127 WP_001085792.1.64181 WP_001085792.1.64192 WP_001085792.1.642 WP_001085792.1.64207 WP_001085792.1.64232 WP_001085792.1.64234 WP_001085792.1.64250 WP_001085792.1.64251 WP_001085792.1.64279 WP_001085792.1.64288 WP_001085792.1.64303 WP_001085792.1.64304 WP_001085792.1.64367 WP_001085792.1.64368 WP_001085792.1.6438 WP_001085792.1.64396 WP_001085792.1.64400 WP_001085792.1.64408 WP_001085792.1.64434 WP_001085792.1.64440 WP_001085792.1.64446 WP_001085792.1.64456 WP_001085792.1.64457 WP_001085792.1.6448 WP_001085792.1.645 WP_001085792.1.64525 WP_001085792.1.6453 WP_001085792.1.64537 WP_001085792.1.64549 WP_001085792.1.64565 WP_001085792.1.64583 WP_001085792.1.6459 WP_001085792.1.64598 WP_001085792.1.6462 WP_001085792.1.64628 WP_001085792.1.64630 WP_001085792.1.64631 WP_001085792.1.64643 WP_001085792.1.64665 WP_001085792.1.64677 WP_001085792.1.64686 WP_001085792.1.64720 WP_001085792.1.64765 WP_001085792.1.6479 WP_001085792.1.64811 WP_001085792.1.64845 WP_001085792.1.64858 WP_001085792.1.64860 WP_001085792.1.64879 WP_001085792.1.6488 WP_001085792.1.64893 WP_001085792.1.64897 WP_001085792.1.64911 WP_001085792.1.64928 WP_001085792.1.64935 WP_001085792.1.64951 WP_001085792.1.64961 WP_001085792.1.64988 WP_001085792.1.64994 WP_001085792.1.64996 WP_001085792.1.64998 WP_001085792.1.65025 WP_001085792.1.65033 WP_001085792.1.65038 WP_001085792.1.65044 WP_001085792.1.65046 WP_001085792.1.65076 WP_001085792.1.6509 WP_001085792.1.65132 WP_001085792.1.65158 WP_001085792.1.65164 WP_001085792.1.65180 WP_001085792.1.65193 WP_001085792.1.65201 WP_001085792.1.65203 WP_001085792.1.65217 WP_001085792.1.65233 WP_001085792.1.65243 WP_001085792.1.65262 WP_001085792.1.65264 WP_001085792.1.65274 WP_001085792.1.6531 WP_001085792.1.65317 WP_001085792.1.65346 WP_001085792.1.65358 WP_001085792.1.65367 WP_001085792.1.65387 WP_001085792.1.65407 WP_001085792.1.65419 WP_001085792.1.65423 WP_001085792.1.65432 WP_001085792.1.6544 WP_001085792.1.65443 WP_001085792.1.65451 WP_001085792.1.6547 WP_001085792.1.65504 WP_001085792.1.6551 WP_001085792.1.65512 WP_001085792.1.65520 WP_001085792.1.65544 WP_001085792.1.65562 WP_001085792.1.65585 WP_001085792.1.6559 WP_001085792.1.65599 WP_001085792.1.65600 WP_001085792.1.65616 WP_001085792.1.65629 WP_001085792.1.65643 WP_001085792.1.65656 WP_001085792.1.65675 WP_001085792.1.6568 WP_001085792.1.65689 WP_001085792.1.65693 WP_001085792.1.65700 WP_001085792.1.65703 WP_001085792.1.65704 WP_001085792.1.65705 WP_001085792.1.65713 WP_001085792.1.65717 WP_001085792.1.65734 WP_001085792.1.65769 WP_001085792.1.6578 WP_001085792.1.65809 WP_001085792.1.6583 WP_001085792.1.6585 WP_001085792.1.65856 WP_001085792.1.65870 WP_001085792.1.65879 WP_001085792.1.65886 WP_001085792.1.65892 WP_001085792.1.65922 WP_001085792.1.65928 WP_001085792.1.65930 WP_001085792.1.65931 WP_001085792.1.65935 WP_001085792.1.65946 WP_001085792.1.65947 WP_001085792.1.65948 WP_001085792.1.65965 WP_001085792.1.65986 WP_001085792.1.65990 WP_001085792.1.66009 WP_001085792.1.66014 WP_001085792.1.6603 WP_001085792.1.66054 WP_001085792.1.66069 WP_001085792.1.66073 WP_001085792.1.66081 WP_001085792.1.661 WP_001085792.1.6612 WP_001085792.1.66120 WP_001085792.1.66130 WP_001085792.1.66133 WP_001085792.1.66144 WP_001085792.1.66175 WP_001085792.1.66227 WP_001085792.1.66262 WP_001085792.1.66265 WP_001085792.1.66287 WP_001085792.1.66298 WP_001085792.1.66302 WP_001085792.1.6632 WP_001085792.1.66322 WP_001085792.1.66328 WP_001085792.1.66366 WP_001085792.1.66433 WP_001085792.1.66453 WP_001085792.1.66482 WP_001085792.1.66505 WP_001085792.1.66513 WP_001085792.1.66518 WP_001085792.1.66519 WP_001085792.1.66542 WP_001085792.1.66556 WP_001085792.1.66564 WP_001085792.1.66588 WP_001085792.1.66598 WP_001085792.1.66601 WP_001085792.1.66606 WP_001085792.1.66611 WP_001085792.1.66614 WP_001085792.1.6662 WP_001085792.1.66628 WP_001085792.1.66645 WP_001085792.1.66664 WP_001085792.1.66677 WP_001085792.1.6668 WP_001085792.1.66690 WP_001085792.1.66705 WP_001085792.1.66711 WP_001085792.1.66726 WP_001085792.1.6674 WP_001085792.1.66756 WP_001085792.1.66765 WP_001085792.1.66766 WP_001085792.1.66786 WP_001085792.1.66792 WP_001085792.1.66803 WP_001085792.1.66816 WP_001085792.1.66818 WP_001085792.1.6684 WP_001085792.1.66853 WP_001085792.1.66879 WP_001085792.1.6688 WP_001085792.1.66904 WP_001085792.1.66906 WP_001085792.1.66938 WP_001085792.1.66969 WP_001085792.1.66996 WP_001085792.1.6700 WP_001085792.1.67012 WP_001085792.1.67014 WP_001085792.1.67016 WP_001085792.1.67063 WP_001085792.1.67067 WP_001085792.1.67112 WP_001085792.1.67113 WP_001085792.1.67135 WP_001085792.1.67147 WP_001085792.1.67152 WP_001085792.1.67155 WP_001085792.1.67160 WP_001085792.1.67161 WP_001085792.1.67191 WP_001085792.1.67212 WP_001085792.1.6722 WP_001085792.1.67238 WP_001085792.1.67251 WP_001085792.1.67259 WP_001085792.1.67266 WP_001085792.1.67286 WP_001085792.1.67294 WP_001085792.1.67296 WP_001085792.1.67312 WP_001085792.1.67329 WP_001085792.1.67333 WP_001085792.1.67375 WP_001085792.1.67379 WP_001085792.1.6740 WP_001085792.1.67414 WP_001085792.1.67418 WP_001085792.1.67425 WP_001085792.1.67447 WP_001085792.1.67457 WP_001085792.1.67463 WP_001085792.1.67480 WP_001085792.1.67505 WP_001085792.1.67507 WP_001085792.1.67520 WP_001085792.1.67521 WP_001085792.1.67540 WP_001085792.1.67554 WP_001085792.1.67571 WP_001085792.1.67572 WP_001085792.1.67620 WP_001085792.1.67621 WP_001085792.1.67632 WP_001085792.1.67651 WP_001085792.1.67652 WP_001085792.1.67653 WP_001085792.1.67691 WP_001085792.1.67712 WP_001085792.1.67713 WP_001085792.1.67722 WP_001085792.1.67754 WP_001085792.1.67762 WP_001085792.1.67798 WP_001085792.1.67800 WP_001085792.1.67808 WP_001085792.1.67815 WP_001085792.1.6786 WP_001085792.1.67864 WP_001085792.1.67865 WP_001085792.1.67867 WP_001085792.1.67880 WP_001085792.1.67925 WP_001085792.1.67931 WP_001085792.1.67986 WP_001085792.1.67991 WP_001085792.1.68020 WP_001085792.1.68033 WP_001085792.1.68054 WP_001085792.1.68066 WP_001085792.1.68101 WP_001085792.1.6811 WP_001085792.1.68111 WP_001085792.1.68134 WP_001085792.1.68139 WP_001085792.1.68141 WP_001085792.1.68152 WP_001085792.1.68160 WP_001085792.1.68161 WP_001085792.1.68199 WP_001085792.1.68202 WP_001085792.1.68221 WP_001085792.1.68223 WP_001085792.1.68233 WP_001085792.1.6824 WP_001085792.1.68261 WP_001085792.1.68268 WP_001085792.1.68286 WP_001085792.1.68295 WP_001085792.1.68299 WP_001085792.1.6830 WP_001085792.1.68307 WP_001085792.1.68334 WP_001085792.1.6834 WP_001085792.1.68343 WP_001085792.1.68351 WP_001085792.1.68355 WP_001085792.1.68366 WP_001085792.1.68367 WP_001085792.1.6839 WP_001085792.1.68392 WP_001085792.1.68397 WP_001085792.1.68398 WP_001085792.1.68399 WP_001085792.1.68404 WP_001085792.1.68425 WP_001085792.1.68466 WP_001085792.1.68470 WP_001085792.1.68476 WP_001085792.1.68479 WP_001085792.1.68483 WP_001085792.1.68489 WP_001085792.1.68504 WP_001085792.1.68505 WP_001085792.1.68522 WP_001085792.1.68548 WP_001085792.1.68565 WP_001085792.1.686 WP_001085792.1.68636 WP_001085792.1.68650 WP_001085792.1.68657 WP_001085792.1.68681 WP_001085792.1.68683 WP_001085792.1.68699 WP_001085792.1.68703 WP_001085792.1.68716 WP_001085792.1.68728 WP_001085792.1.68737 WP_001085792.1.68741 WP_001085792.1.68743 WP_001085792.1.68747 WP_001085792.1.68773 WP_001085792.1.68775 WP_001085792.1.68813 WP_001085792.1.68831 WP_001085792.1.68854 WP_001085792.1.68864 WP_001085792.1.68875 WP_001085792.1.68878 WP_001085792.1.68883 WP_001085792.1.68931 WP_001085792.1.68943 WP_001085792.1.68944 WP_001085792.1.68987 WP_001085792.1.68988 WP_001085792.1.68998 WP_001085792.1.69012 WP_001085792.1.69016 WP_001085792.1.69045 WP_001085792.1.69071 WP_001085792.1.69078 WP_001085792.1.69087 WP_001085792.1.69089 WP_001085792.1.691 WP_001085792.1.69105 WP_001085792.1.69120 WP_001085792.1.69147 WP_001085792.1.6915 WP_001085792.1.69162 WP_001085792.1.6917 WP_001085792.1.69179 WP_001085792.1.69191 WP_001085792.1.69198 WP_001085792.1.69219 WP_001085792.1.69222 WP_001085792.1.69232 WP_001085792.1.69237 WP_001085792.1.69239 WP_001085792.1.69251 WP_001085792.1.69266 WP_001085792.1.69349 WP_001085792.1.69361 WP_001085792.1.69366 WP_001085792.1.69394 WP_001085792.1.69395 WP_001085792.1.69409 WP_001085792.1.69412 WP_001085792.1.69415 WP_001085792.1.6943 WP_001085792.1.69434 WP_001085792.1.69437 WP_001085792.1.69475 WP_001085792.1.69476 WP_001085792.1.69480 WP_001085792.1.69483 WP_001085792.1.69489 WP_001085792.1.695 WP_001085792.1.69520 WP_001085792.1.6953 WP_001085792.1.69546 WP_001085792.1.69552 WP_001085792.1.69563 WP_001085792.1.69598 WP_001085792.1.69622 WP_001085792.1.69639 WP_001085792.1.69679 WP_001085792.1.6968 WP_001085792.1.69680 WP_001085792.1.69721 WP_001085792.1.69724 WP_001085792.1.69762 WP_001085792.1.6980 WP_001085792.1.69820 WP_001085792.1.69823 WP_001085792.1.69830 WP_001085792.1.69842 WP_001085792.1.69877 WP_001085792.1.69878 WP_001085792.1.69882 WP_001085792.1.699 WP_001085792.1.69902 WP_001085792.1.69921 WP_001085792.1.69934 WP_001085792.1.69980 WP_001085792.1.69987 WP_001085792.1.69995 WP_001085792.1.70024 WP_001085792.1.70048 WP_001085792.1.70059 WP_001085792.1.70094 WP_001085792.1.70105 WP_001085792.1.7012 WP_001085792.1.70133 WP_001085792.1.70161 WP_001085792.1.70210 WP_001085792.1.70220 WP_001085792.1.70225 WP_001085792.1.70228 WP_001085792.1.7024 WP_001085792.1.70253 WP_001085792.1.70266 WP_001085792.1.70273 WP_001085792.1.70294 WP_001085792.1.703 WP_001085792.1.70311 WP_001085792.1.70313 WP_001085792.1.70334 WP_001085792.1.7034 WP_001085792.1.70344 WP_001085792.1.70349 WP_001085792.1.70353 WP_001085792.1.70413 WP_001085792.1.7043 WP_001085792.1.70441 WP_001085792.1.70448 WP_001085792.1.70451 WP_001085792.1.70457 WP_001085792.1.70459 WP_001085792.1.7046 WP_001085792.1.70462 WP_001085792.1.70487 WP_001085792.1.70495 WP_001085792.1.70527 WP_001085792.1.7053 WP_001085792.1.70541 WP_001085792.1.70546 WP_001085792.1.70554 WP_001085792.1.70558 WP_001085792.1.70564 WP_001085792.1.70587 WP_001085792.1.706 WP_001085792.1.7061 WP_001085792.1.70611 WP_001085792.1.70635 WP_001085792.1.7064 WP_001085792.1.70641 WP_001085792.1.7065 WP_001085792.1.70664 WP_001085792.1.7067 WP_001085792.1.70672 WP_001085792.1.707 WP_001085792.1.70721 WP_001085792.1.7073 WP_001085792.1.70763 WP_001085792.1.70807 WP_001085792.1.70808 WP_001085792.1.70818 WP_001085792.1.70823 WP_001085792.1.70829 WP_001085792.1.70835 WP_001085792.1.70843 WP_001085792.1.70850 WP_001085792.1.70855 WP_001085792.1.70909 WP_001085792.1.70924 WP_001085792.1.70926 WP_001085792.1.70930 WP_001085792.1.70939 WP_001085792.1.70943 WP_001085792.1.70994 WP_001085792.1.710 WP_001085792.1.71016 WP_001085792.1.71027 WP_001085792.1.71032 WP_001085792.1.71043 WP_001085792.1.7105 WP_001085792.1.71058 WP_001085792.1.71059 WP_001085792.1.71073 WP_001085792.1.7109 WP_001085792.1.71130 WP_001085792.1.71143 WP_001085792.1.71179 WP_001085792.1.71182 WP_001085792.1.7119 WP_001085792.1.71196 WP_001085792.1.7120 WP_001085792.1.71208 WP_001085792.1.71231 WP_001085792.1.71236 WP_001085792.1.7125 WP_001085792.1.71257 WP_001085792.1.71266 WP_001085792.1.71267 WP_001085792.1.71280 WP_001085792.1.71295 WP_001085792.1.71298 WP_001085792.1.71301 WP_001085792.1.71313 WP_001085792.1.71316 WP_001085792.1.71325 WP_001085792.1.71345 WP_001085792.1.71359 WP_001085792.1.71404 WP_001085792.1.71410 WP_001085792.1.71416 WP_001085792.1.71419 WP_001085792.1.71428 WP_001085792.1.71438 WP_001085792.1.71463 WP_001085792.1.71466 WP_001085792.1.71467 WP_001085792.1.71475 WP_001085792.1.71483 WP_001085792.1.7150 WP_001085792.1.71519 WP_001085792.1.71529 WP_001085792.1.71541 WP_001085792.1.71543 WP_001085792.1.71547 WP_001085792.1.71572 WP_001085792.1.71575 WP_001085792.1.7158 WP_001085792.1.71590 WP_001085792.1.71596 WP_001085792.1.71602 WP_001085792.1.7161 WP_001085792.1.7164 WP_001085792.1.71662 WP_001085792.1.71676 WP_001085792.1.71707 WP_001085792.1.71715 WP_001085792.1.71721 WP_001085792.1.71735 WP_001085792.1.71737 WP_001085792.1.71739 WP_001085792.1.71741 WP_001085792.1.71771 WP_001085792.1.71780 WP_001085792.1.7179 WP_001085792.1.71800 WP_001085792.1.71828 WP_001085792.1.71836 WP_001085792.1.71861 WP_001085792.1.71877 WP_001085792.1.71892 WP_001085792.1.71910 WP_001085792.1.71925 WP_001085792.1.7193 WP_001085792.1.71978 WP_001085792.1.71981 WP_001085792.1.71989 WP_001085792.1.72002 WP_001085792.1.72018 WP_001085792.1.72026 WP_001085792.1.72031 WP_001085792.1.72067 WP_001085792.1.72085 WP_001085792.1.72102 WP_001085792.1.72118 WP_001085792.1.72148 WP_001085792.1.72169 WP_001085792.1.72176 WP_001085792.1.72204 WP_001085792.1.72205 WP_001085792.1.72224 WP_001085792.1.72257 WP_001085792.1.72271 WP_001085792.1.72285 WP_001085792.1.72306 WP_001085792.1.72315 WP_001085792.1.72330 WP_001085792.1.72340 WP_001085792.1.72347 WP_001085792.1.7236 WP_001085792.1.72363 WP_001085792.1.72366 WP_001085792.1.72371 WP_001085792.1.72424 WP_001085792.1.72446 WP_001085792.1.72453 WP_001085792.1.72465 WP_001085792.1.72478 WP_001085792.1.72489 WP_001085792.1.72496 WP_001085792.1.72497 WP_001085792.1.72529 WP_001085792.1.7254 WP_001085792.1.72547 WP_001085792.1.72564 WP_001085792.1.7258 WP_001085792.1.7260 WP_001085792.1.72626 WP_001085792.1.72649 WP_001085792.1.72654 WP_001085792.1.72666 WP_001085792.1.72708 WP_001085792.1.72719 WP_001085792.1.72750 WP_001085792.1.72753 WP_001085792.1.72760 WP_001085792.1.72762 WP_001085792.1.72787 WP_001085792.1.72816 WP_001085792.1.72832 WP_001085792.1.72834 WP_001085792.1.72835 WP_001085792.1.72874 WP_001085792.1.72881 WP_001085792.1.72903 WP_001085792.1.72904 WP_001085792.1.72935 WP_001085792.1.7294 WP_001085792.1.72945 WP_001085792.1.72961 WP_001085792.1.72991 WP_001085792.1.73002 WP_001085792.1.73017 WP_001085792.1.73019 WP_001085792.1.73021 WP_001085792.1.73022 WP_001085792.1.73034 WP_001085792.1.73037 WP_001085792.1.73046 WP_001085792.1.73087 WP_001085792.1.73121 WP_001085792.1.73122 WP_001085792.1.73132 WP_001085792.1.73140 WP_001085792.1.73190 WP_001085792.1.73191 WP_001085792.1.73195 WP_001085792.1.73201 WP_001085792.1.73211 WP_001085792.1.73240 WP_001085792.1.73241 WP_001085792.1.73246 WP_001085792.1.7326 WP_001085792.1.73264 WP_001085792.1.73265 WP_001085792.1.73286 WP_001085792.1.73386 WP_001085792.1.73401 WP_001085792.1.73402 WP_001085792.1.73420 WP_001085792.1.73444 WP_001085792.1.73450 WP_001085792.1.73456 WP_001085792.1.73464 WP_001085792.1.73489 WP_001085792.1.73501 WP_001085792.1.73513 WP_001085792.1.73536 WP_001085792.1.73539 WP_001085792.1.73547 WP_001085792.1.73571 WP_001085792.1.73591 WP_001085792.1.736 WP_001085792.1.7360 WP_001085792.1.73610 WP_001085792.1.73639 WP_001085792.1.73640 WP_001085792.1.73674 WP_001085792.1.73685 WP_001085792.1.73687 WP_001085792.1.73693 WP_001085792.1.73694 WP_001085792.1.73735 WP_001085792.1.73759 WP_001085792.1.73786 WP_001085792.1.73789 WP_001085792.1.7380 WP_001085792.1.73834 WP_001085792.1.73837 WP_001085792.1.73853 WP_001085792.1.73858 WP_001085792.1.73868 WP_001085792.1.73885 WP_001085792.1.73900 WP_001085792.1.73902 WP_001085792.1.73910 WP_001085792.1.73920 WP_001085792.1.73921 WP_001085792.1.73940 WP_001085792.1.73949 WP_001085792.1.73961 WP_001085792.1.73969 WP_001085792.1.73971 WP_001085792.1.73976 WP_001085792.1.73983 WP_001085792.1.74004 WP_001085792.1.74006 WP_001085792.1.74008 WP_001085792.1.7401 WP_001085792.1.74010 WP_001085792.1.74025 WP_001085792.1.74027 WP_001085792.1.7406 WP_001085792.1.74073 WP_001085792.1.74081 WP_001085792.1.74085 WP_001085792.1.74138 WP_001085792.1.74155 WP_001085792.1.74161 WP_001085792.1.74172 WP_001085792.1.74173 WP_001085792.1.74183 WP_001085792.1.74216 WP_001085792.1.74221 WP_001085792.1.74234 WP_001085792.1.74237 WP_001085792.1.74242 WP_001085792.1.74257 WP_001085792.1.7427 WP_001085792.1.74273 WP_001085792.1.74284 WP_001085792.1.74295 WP_001085792.1.74327 WP_001085792.1.7434 WP_001085792.1.74353 WP_001085792.1.74356 WP_001085792.1.74380 WP_001085792.1.74390 WP_001085792.1.74429 WP_001085792.1.74456 WP_001085792.1.74457 WP_001085792.1.74468 WP_001085792.1.74474 WP_001085792.1.74497 WP_001085792.1.74510 WP_001085792.1.7457 WP_001085792.1.74576 WP_001085792.1.74587 WP_001085792.1.74590 WP_001085792.1.74610 WP_001085792.1.74638 WP_001085792.1.74645 WP_001085792.1.74676 WP_001085792.1.74693 WP_001085792.1.74696 WP_001085792.1.74704 WP_001085792.1.74731 WP_001085792.1.74747 WP_001085792.1.74758 WP_001085792.1.74761 WP_001085792.1.74770 WP_001085792.1.74775 WP_001085792.1.74785 WP_001085792.1.74797 WP_001085792.1.74802 WP_001085792.1.74808 WP_001085792.1.7482 WP_001085792.1.74840 WP_001085792.1.74846 WP_001085792.1.74866 WP_001085792.1.74874 WP_001085792.1.74890 WP_001085792.1.74911 WP_001085792.1.74922 WP_001085792.1.74924 WP_001085792.1.74961 WP_001085792.1.74978 WP_001085792.1.74985 WP_001085792.1.74994 WP_001085792.1.74999 WP_001085792.1.75038 WP_001085792.1.75044 WP_001085792.1.75052 WP_001085792.1.75070 WP_001085792.1.75093 WP_001085792.1.75111 WP_001085792.1.75127 WP_001085792.1.75131 WP_001085792.1.75132 WP_001085792.1.75141 WP_001085792.1.75186 WP_001085792.1.75227 WP_001085792.1.75252 WP_001085792.1.75253 WP_001085792.1.75294 WP_001085792.1.75298 WP_001085792.1.75304 WP_001085792.1.75320 WP_001085792.1.75323 WP_001085792.1.75327 WP_001085792.1.75349 WP_001085792.1.75351 WP_001085792.1.75356 WP_001085792.1.75365 WP_001085792.1.75375 WP_001085792.1.75379 WP_001085792.1.75399 WP_001085792.1.75409 WP_001085792.1.7542 WP_001085792.1.75438 WP_001085792.1.75440 WP_001085792.1.75521 WP_001085792.1.75527 WP_001085792.1.75538 WP_001085792.1.75551 WP_001085792.1.75566 WP_001085792.1.75571 WP_001085792.1.75590 WP_001085792.1.7561 WP_001085792.1.75647 WP_001085792.1.75649 WP_001085792.1.75652 WP_001085792.1.75685 WP_001085792.1.75692 WP_001085792.1.75704 WP_001085792.1.75728 WP_001085792.1.75769 WP_001085792.1.75775 WP_001085792.1.758 WP_001085792.1.75800 WP_001085792.1.75805 WP_001085792.1.75809 WP_001085792.1.75830 WP_001085792.1.75840 WP_001085792.1.75848 WP_001085792.1.75851 WP_001085792.1.75862 WP_001085792.1.75881 WP_001085792.1.75885 WP_001085792.1.75910 WP_001085792.1.75929 WP_001085792.1.75944 WP_001085792.1.75952 WP_001085792.1.75956 WP_001085792.1.7596 WP_001085792.1.75969 WP_001085792.1.76010 WP_001085792.1.76013 WP_001085792.1.76015 WP_001085792.1.7602 WP_001085792.1.76047 WP_001085792.1.76049 WP_001085792.1.76050 WP_001085792.1.76053 WP_001085792.1.7607 WP_001085792.1.76095 WP_001085792.1.76104 WP_001085792.1.76111 WP_001085792.1.76114 WP_001085792.1.76121 WP_001085792.1.76123 WP_001085792.1.76143 WP_001085792.1.76149 WP_001085792.1.76153 WP_001085792.1.76179 WP_001085792.1.76221 WP_001085792.1.76230 WP_001085792.1.76234 WP_001085792.1.7624 WP_001085792.1.7625 WP_001085792.1.76258 WP_001085792.1.76261 WP_001085792.1.76282 WP_001085792.1.76283 WP_001085792.1.76294 WP_001085792.1.76295 WP_001085792.1.76313 WP_001085792.1.76332 WP_001085792.1.76337 WP_001085792.1.76351 WP_001085792.1.76411 WP_001085792.1.76419 WP_001085792.1.76420 WP_001085792.1.76421 WP_001085792.1.76426 WP_001085792.1.76431 WP_001085792.1.76463 WP_001085792.1.76482 WP_001085792.1.76497 WP_001085792.1.765 WP_001085792.1.76528 WP_001085792.1.7658 WP_001085792.1.76606 WP_001085792.1.76624 WP_001085792.1.76648 WP_001085792.1.76659 WP_001085792.1.76674 WP_001085792.1.76686 WP_001085792.1.76689 WP_001085792.1.76690 WP_001085792.1.76693 WP_001085792.1.76711 WP_001085792.1.76718 WP_001085792.1.7675 WP_001085792.1.76790 WP_001085792.1.76792 WP_001085792.1.76798 WP_001085792.1.768 WP_001085792.1.76803 WP_001085792.1.76816 WP_001085792.1.76820 WP_001085792.1.76825 WP_001085792.1.76829 WP_001085792.1.76839 WP_001085792.1.76845 WP_001085792.1.76869 WP_001085792.1.76872 WP_001085792.1.76876 WP_001085792.1.76878 WP_001085792.1.76895 WP_001085792.1.76897 WP_001085792.1.76920 WP_001085792.1.76921 WP_001085792.1.76937 WP_001085792.1.7694 WP_001085792.1.76944 WP_001085792.1.76952 WP_001085792.1.76998 WP_001085792.1.77020 WP_001085792.1.77031 WP_001085792.1.77041 WP_001085792.1.77043 WP_001085792.1.77050 WP_001085792.1.77060 WP_001085792.1.77062 WP_001085792.1.77069 WP_001085792.1.77072 WP_001085792.1.77112 WP_001085792.1.77137 WP_001085792.1.77144 WP_001085792.1.77145 WP_001085792.1.77158 WP_001085792.1.77183 WP_001085792.1.77190 WP_001085792.1.77203 WP_001085792.1.77229 WP_001085792.1.77256 WP_001085792.1.77297 WP_001085792.1.77298 WP_001085792.1.77305 WP_001085792.1.77315 WP_001085792.1.77331 WP_001085792.1.77359 WP_001085792.1.77383 WP_001085792.1.77416 WP_001085792.1.77426 WP_001085792.1.7745 WP_001085792.1.7746 WP_001085792.1.77460 WP_001085792.1.77485 WP_001085792.1.77489 WP_001085792.1.77497 WP_001085792.1.77498 WP_001085792.1.7752 WP_001085792.1.77520 WP_001085792.1.77527 WP_001085792.1.77532 WP_001085792.1.77533 WP_001085792.1.77536 WP_001085792.1.77572 WP_001085792.1.77583 WP_001085792.1.77603 WP_001085792.1.77606 WP_001085792.1.77650 WP_001085792.1.77665 WP_001085792.1.77730 WP_001085792.1.77733 WP_001085792.1.77735 WP_001085792.1.77738 WP_001085792.1.7774 WP_001085792.1.77743 WP_001085792.1.77763 WP_001085792.1.77791 WP_001085792.1.77814 WP_001085792.1.77818 WP_001085792.1.77822 WP_001085792.1.77848 WP_001085792.1.7785 WP_001085792.1.77858 WP_001085792.1.7786 WP_001085792.1.77860 WP_001085792.1.7787 WP_001085792.1.77882 WP_001085792.1.77883 WP_001085792.1.77915 WP_001085792.1.77922 WP_001085792.1.77930 WP_001085792.1.77952 WP_001085792.1.77957 WP_001085792.1.77986 WP_001085792.1.78038 WP_001085792.1.78054 WP_001085792.1.78067 WP_001085792.1.78082 WP_001085792.1.78091 WP_001085792.1.78095 WP_001085792.1.7810 WP_001085792.1.78116 WP_001085792.1.78164 WP_001085792.1.78173 WP_001085792.1.78179 WP_001085792.1.78189 WP_001085792.1.78194 WP_001085792.1.78207 WP_001085792.1.78208 WP_001085792.1.78210 WP_001085792.1.78252 WP_001085792.1.78254 WP_001085792.1.78257 WP_001085792.1.7827 WP_001085792.1.78304 WP_001085792.1.78311 WP_001085792.1.78324 WP_001085792.1.7833 WP_001085792.1.78330 WP_001085792.1.78332 WP_001085792.1.78335 WP_001085792.1.78365 WP_001085792.1.78371 WP_001085792.1.78392 WP_001085792.1.78404 WP_001085792.1.78434 WP_001085792.1.78436 WP_001085792.1.78470 WP_001085792.1.78478 WP_001085792.1.78489 WP_001085792.1.78494 WP_001085792.1.7850 WP_001085792.1.78513 WP_001085792.1.7853 WP_001085792.1.78558 WP_001085792.1.7857 WP_001085792.1.78573 WP_001085792.1.78585 WP_001085792.1.78592 WP_001085792.1.78598 WP_001085792.1.78604 WP_001085792.1.78638 WP_001085792.1.78653 WP_001085792.1.78667 WP_001085792.1.7868 WP_001085792.1.78685 WP_001085792.1.78708 WP_001085792.1.78728 WP_001085792.1.78731 WP_001085792.1.78736 WP_001085792.1.78763 WP_001085792.1.78785 WP_001085792.1.78803 WP_001085792.1.78816 WP_001085792.1.78819 WP_001085792.1.78841 WP_001085792.1.78897 WP_001085792.1.78920 WP_001085792.1.78937 WP_001085792.1.78946 WP_001085792.1.78978 WP_001085792.1.78983 WP_001085792.1.78985 WP_001085792.1.78991 WP_001085792.1.78995 WP_001085792.1.7900 WP_001085792.1.79006 WP_001085792.1.79038 WP_001085792.1.7905 WP_001085792.1.79051 WP_001085792.1.79055 WP_001085792.1.79059 WP_001085792.1.79085 WP_001085792.1.79110 WP_001085792.1.79131 WP_001085792.1.79132 WP_001085792.1.79143 WP_001085792.1.79156 WP_001085792.1.79170 WP_001085792.1.79178 WP_001085792.1.79192 WP_001085792.1.79197 WP_001085792.1.79208 WP_001085792.1.79223 WP_001085792.1.79227 WP_001085792.1.79270 WP_001085792.1.79275 WP_001085792.1.79285 WP_001085792.1.7930 WP_001085792.1.7931 WP_001085792.1.79310 WP_001085792.1.79314 WP_001085792.1.79322 WP_001085792.1.79332 WP_001085792.1.7934 WP_001085792.1.79341 WP_001085792.1.79367 WP_001085792.1.79374 WP_001085792.1.79378 WP_001085792.1.79379 WP_001085792.1.79400 WP_001085792.1.79402 WP_001085792.1.79407 WP_001085792.1.79408 WP_001085792.1.79436 WP_001085792.1.79452 WP_001085792.1.79461 WP_001085792.1.79476 WP_001085792.1.79487 WP_001085792.1.79539 WP_001085792.1.79552 WP_001085792.1.79554 WP_001085792.1.79556 WP_001085792.1.79566 WP_001085792.1.79581 WP_001085792.1.79626 WP_001085792.1.79627 WP_001085792.1.79638 WP_001085792.1.79662 WP_001085792.1.79664 WP_001085792.1.79672 WP_001085792.1.79676 WP_001085792.1.79677 WP_001085792.1.79706 WP_001085792.1.79731 WP_001085792.1.79737 WP_001085792.1.79763 WP_001085792.1.7981 WP_001085792.1.79822 WP_001085792.1.79831 WP_001085792.1.79834 WP_001085792.1.79837 WP_001085792.1.79854 WP_001085792.1.79855 WP_001085792.1.7989 WP_001085792.1.79896 WP_001085792.1.79904 WP_001085792.1.79911 WP_001085792.1.7992 WP_001085792.1.79941 WP_001085792.1.79949 WP_001085792.1.79961 WP_001085792.1.79971 WP_001085792.1.79991 WP_001085792.1.80000 WP_001085792.1.80009 WP_001085792.1.80013 WP_001085792.1.80029 WP_001085792.1.80032 WP_001085792.1.80042 WP_001085792.1.80079 WP_001085792.1.80086 WP_001085792.1.80109 WP_001085792.1.80119 WP_001085792.1.80120 WP_001085792.1.80122 WP_001085792.1.80124 WP_001085792.1.80127 WP_001085792.1.80146 WP_001085792.1.80152 WP_001085792.1.80178 WP_001085792.1.80181 WP_001085792.1.80193 WP_001085792.1.80203 WP_001085792.1.80206 WP_001085792.1.80210 WP_001085792.1.80244 WP_001085792.1.80274 WP_001085792.1.80286 WP_001085792.1.80287 WP_001085792.1.80290 WP_001085792.1.80297 WP_001085792.1.8030 WP_001085792.1.80308 WP_001085792.1.8031 WP_001085792.1.80316 WP_001085792.1.80317 WP_001085792.1.80336 WP_001085792.1.8035 WP_001085792.1.80358 WP_001085792.1.80378 WP_001085792.1.80393 WP_001085792.1.8040 WP_001085792.1.80407 WP_001085792.1.80414 WP_001085792.1.8043 WP_001085792.1.80430 WP_001085792.1.80434 WP_001085792.1.8045 WP_001085792.1.8047 WP_001085792.1.80472 WP_001085792.1.80521 WP_001085792.1.80530 WP_001085792.1.80582 WP_001085792.1.8062 WP_001085792.1.80647 WP_001085792.1.8065 WP_001085792.1.80653 WP_001085792.1.80680 WP_001085792.1.80687 WP_001085792.1.80717 WP_001085792.1.80721 WP_001085792.1.80734 WP_001085792.1.80745 WP_001085792.1.80761 WP_001085792.1.80762 WP_001085792.1.80763 WP_001085792.1.8077 WP_001085792.1.80781 WP_001085792.1.80786 WP_001085792.1.80833 WP_001085792.1.8084 WP_001085792.1.80845 WP_001085792.1.80855 WP_001085792.1.80872 WP_001085792.1.80899 WP_001085792.1.80962 WP_001085792.1.80972 WP_001085792.1.81010 WP_001085792.1.81022 WP_001085792.1.81049 WP_001085792.1.81052 WP_001085792.1.81055 WP_001085792.1.81064 WP_001085792.1.81065 WP_001085792.1.81085 WP_001085792.1.81095 WP_001085792.1.81097 WP_001085792.1.81114 WP_001085792.1.81132 WP_001085792.1.81151 WP_001085792.1.81154 WP_001085792.1.81157 WP_001085792.1.81162 WP_001085792.1.81171 WP_001085792.1.81172 WP_001085792.1.81176 WP_001085792.1.81184 WP_001085792.1.81214 WP_001085792.1.81224 WP_001085792.1.81228 WP_001085792.1.81232 WP_001085792.1.81234 WP_001085792.1.81243 WP_001085792.1.8125 WP_001085792.1.81252 WP_001085792.1.81288 WP_001085792.1.81290 WP_001085792.1.81344 WP_001085792.1.8135 WP_001085792.1.81379 WP_001085792.1.81384 WP_001085792.1.81385 WP_001085792.1.81387 WP_001085792.1.81389 WP_001085792.1.8142 WP_001085792.1.8144 WP_001085792.1.81464 WP_001085792.1.81467 WP_001085792.1.81508 WP_001085792.1.81522 WP_001085792.1.81532 WP_001085792.1.81574 WP_001085792.1.81599 WP_001085792.1.8160 WP_001085792.1.81604 WP_001085792.1.81610 WP_001085792.1.81619 WP_001085792.1.81645 WP_001085792.1.81651 WP_001085792.1.81738 WP_001085792.1.81740 WP_001085792.1.81749 WP_001085792.1.81758 WP_001085792.1.81767 WP_001085792.1.81789 WP_001085792.1.8180 WP_001085792.1.81800 WP_001085792.1.81810 WP_001085792.1.81811 WP_001085792.1.81812 WP_001085792.1.81829 WP_001085792.1.81831 WP_001085792.1.81837 WP_001085792.1.81838 WP_001085792.1.81847 WP_001085792.1.8185 WP_001085792.1.81861 WP_001085792.1.81870 WP_001085792.1.81897 WP_001085792.1.81903 WP_001085792.1.81905 WP_001085792.1.81906 WP_001085792.1.81919 WP_001085792.1.81944 WP_001085792.1.81955 WP_001085792.1.81969 WP_001085792.1.81982 WP_001085792.1.81999 WP_001085792.1.82009 WP_001085792.1.82017 WP_001085792.1.82026 WP_001085792.1.82053 WP_001085792.1.82058 WP_001085792.1.8206 WP_001085792.1.82091 WP_001085792.1.82100 WP_001085792.1.82103 WP_001085792.1.8212 WP_001085792.1.82121 WP_001085792.1.8213 WP_001085792.1.82174 WP_001085792.1.82184 WP_001085792.1.82219 WP_001085792.1.82234 WP_001085792.1.82247 WP_001085792.1.82253 WP_001085792.1.82259 WP_001085792.1.82278 WP_001085792.1.82281 WP_001085792.1.82301 WP_001085792.1.82315 WP_001085792.1.82321 WP_001085792.1.82340 WP_001085792.1.82349 WP_001085792.1.82354 WP_001085792.1.82358 WP_001085792.1.82368 WP_001085792.1.82406 WP_001085792.1.82441 WP_001085792.1.82447 WP_001085792.1.82455 WP_001085792.1.82458 WP_001085792.1.8246 WP_001085792.1.82467 WP_001085792.1.82468 WP_001085792.1.82472 WP_001085792.1.82525 WP_001085792.1.82548 WP_001085792.1.82558 WP_001085792.1.8260 WP_001085792.1.8261 WP_001085792.1.82612 WP_001085792.1.8265 WP_001085792.1.8266 WP_001085792.1.82664 WP_001085792.1.82665 WP_001085792.1.82678 WP_001085792.1.82709 WP_001085792.1.82724 WP_001085792.1.82768 WP_001085792.1.82775 WP_001085792.1.82796 WP_001085792.1.8280 WP_001085792.1.82802 WP_001085792.1.82824 WP_001085792.1.82829 WP_001085792.1.82855 WP_001085792.1.82862 WP_001085792.1.8288 WP_001085792.1.8289 WP_001085792.1.82930 WP_001085792.1.82941 WP_001085792.1.82976 WP_001085792.1.82980 WP_001085792.1.8302 WP_001085792.1.83021 WP_001085792.1.83046 WP_001085792.1.83054 WP_001085792.1.83066 WP_001085792.1.83078 WP_001085792.1.83086 WP_001085792.1.83088 WP_001085792.1.8310 WP_001085792.1.83103 WP_001085792.1.83152 WP_001085792.1.83153 WP_001085792.1.8318 WP_001085792.1.83185 WP_001085792.1.8319 WP_001085792.1.83193 WP_001085792.1.83203 WP_001085792.1.83234 WP_001085792.1.83249 WP_001085792.1.83250 WP_001085792.1.8328 WP_001085792.1.83291 WP_001085792.1.83314 WP_001085792.1.83316 WP_001085792.1.83352 WP_001085792.1.83359 WP_001085792.1.83372 WP_001085792.1.83405 WP_001085792.1.83417 WP_001085792.1.83418 WP_001085792.1.8346 WP_001085792.1.83467 WP_001085792.1.83468 WP_001085792.1.83472 WP_001085792.1.83476 WP_001085792.1.83479 WP_001085792.1.83484 WP_001085792.1.83508 WP_001085792.1.83517 WP_001085792.1.83520 WP_001085792.1.83541 WP_001085792.1.83553 WP_001085792.1.83593 WP_001085792.1.83597 WP_001085792.1.83599 WP_001085792.1.83624 WP_001085792.1.83646 WP_001085792.1.83652 WP_001085792.1.83653 WP_001085792.1.8366 WP_001085792.1.83674 WP_001085792.1.83676 WP_001085792.1.83720 WP_001085792.1.83728 WP_001085792.1.83750 WP_001085792.1.83756 WP_001085792.1.83758 WP_001085792.1.83763 WP_001085792.1.83769 WP_001085792.1.83770 WP_001085792.1.83775 WP_001085792.1.83788 WP_001085792.1.83792 WP_001085792.1.83797 WP_001085792.1.83804 WP_001085792.1.83816 WP_001085792.1.83825 WP_001085792.1.8383 WP_001085792.1.83864 WP_001085792.1.83865 WP_001085792.1.83868 WP_001085792.1.83881 WP_001085792.1.83886 WP_001085792.1.83905 WP_001085792.1.83912 WP_001085792.1.83919 WP_001085792.1.83928 WP_001085792.1.83955 WP_001085792.1.83980 WP_001085792.1.83984 WP_001085792.1.83989 WP_001085792.1.84010 WP_001085792.1.84025 WP_001085792.1.84049 WP_001085792.1.84054 WP_001085792.1.84064 WP_001085792.1.84118 WP_001085792.1.84129 WP_001085792.1.84144 WP_001085792.1.84161 WP_001085792.1.84163 WP_001085792.1.84188 WP_001085792.1.84194 WP_001085792.1.84275 WP_001085792.1.84293 WP_001085792.1.8432 WP_001085792.1.84342 WP_001085792.1.84414 WP_001085792.1.84415 WP_001085792.1.84418 WP_001085792.1.84442 WP_001085792.1.84445 WP_001085792.1.84451 WP_001085792.1.84508 WP_001085792.1.84509 WP_001085792.1.84563 WP_001085792.1.84578 WP_001085792.1.84590 WP_001085792.1.84596 WP_001085792.1.84608 WP_001085792.1.8462 WP_001085792.1.84625 WP_001085792.1.84638 WP_001085792.1.84648 WP_001085792.1.84673 WP_001085792.1.84679 WP_001085792.1.8468 WP_001085792.1.84682 WP_001085792.1.84696 WP_001085792.1.84700 WP_001085792.1.84714 WP_001085792.1.84736 WP_001085792.1.8475 WP_001085792.1.84752 WP_001085792.1.84757 WP_001085792.1.84761 WP_001085792.1.84767 WP_001085792.1.84770 WP_001085792.1.84776 WP_001085792.1.84815 WP_001085792.1.8482 WP_001085792.1.84826 WP_001085792.1.84844 WP_001085792.1.84847 WP_001085792.1.84854 WP_001085792.1.84874 WP_001085792.1.84889 WP_001085792.1.84903 WP_001085792.1.84907 WP_001085792.1.84922 WP_001085792.1.8493 WP_001085792.1.84943 WP_001085792.1.84951 WP_001085792.1.8496 WP_001085792.1.84975 WP_001085792.1.84978 WP_001085792.1.85017 WP_001085792.1.85022 WP_001085792.1.85026 WP_001085792.1.85045 WP_001085792.1.85047 WP_001085792.1.85056 WP_001085792.1.85070 WP_001085792.1.85081 WP_001085792.1.85099 WP_001085792.1.85113 WP_001085792.1.85118 WP_001085792.1.85133 WP_001085792.1.85135 WP_001085792.1.85144 WP_001085792.1.85151 WP_001085792.1.85160 WP_001085792.1.85173 WP_001085792.1.85198 WP_001085792.1.85213 WP_001085792.1.85226 WP_001085792.1.85229 WP_001085792.1.85231 WP_001085792.1.85235 WP_001085792.1.85238 WP_001085792.1.85265 WP_001085792.1.85289 WP_001085792.1.85292 WP_001085792.1.85302 WP_001085792.1.85331 WP_001085792.1.85351 WP_001085792.1.85354 WP_001085792.1.85374 WP_001085792.1.85375 WP_001085792.1.85376 WP_001085792.1.85383 WP_001085792.1.85391 WP_001085792.1.85395 WP_001085792.1.85401 WP_001085792.1.85404 WP_001085792.1.85409 WP_001085792.1.85425 WP_001085792.1.85440 WP_001085792.1.85441 WP_001085792.1.85445 WP_001085792.1.85462 WP_001085792.1.85471 WP_001085792.1.85474 WP_001085792.1.85485 WP_001085792.1.85492 WP_001085792.1.85506 WP_001085792.1.8551 WP_001085792.1.85515 WP_001085792.1.85519 WP_001085792.1.85547 WP_001085792.1.85549 WP_001085792.1.85555 WP_001085792.1.85562 WP_001085792.1.85585 WP_001085792.1.85586 WP_001085792.1.85596 WP_001085792.1.85611 WP_001085792.1.85634 WP_001085792.1.85649 WP_001085792.1.8572 WP_001085792.1.85732 WP_001085792.1.85758 WP_001085792.1.8576 WP_001085792.1.85795 WP_001085792.1.85796 WP_001085792.1.85816 WP_001085792.1.85825 WP_001085792.1.85834 WP_001085792.1.85858 WP_001085792.1.85906 WP_001085792.1.85924 WP_001085792.1.85927 WP_001085792.1.85950 WP_001085792.1.85971 WP_001085792.1.85980 WP_001085792.1.85989 WP_001085792.1.85993 WP_001085792.1.86018 WP_001085792.1.86036 WP_001085792.1.86042 WP_001085792.1.86072 WP_001085792.1.86086 WP_001085792.1.8609 WP_001085792.1.86136 WP_001085792.1.86144 WP_001085792.1.86153 WP_001085792.1.86154 WP_001085792.1.86158 WP_001085792.1.8617 WP_001085792.1.86188 WP_001085792.1.86197 WP_001085792.1.86202 WP_001085792.1.86207 WP_001085792.1.86241 WP_001085792.1.86248 WP_001085792.1.8627 WP_001085792.1.86270 WP_001085792.1.86281 WP_001085792.1.86298 WP_001085792.1.86304 WP_001085792.1.86315 WP_001085792.1.86331 WP_001085792.1.86344 WP_001085792.1.86363 WP_001085792.1.86367 WP_001085792.1.86378 WP_001085792.1.8641 WP_001085792.1.8643 WP_001085792.1.86439 WP_001085792.1.86455 WP_001085792.1.86482 WP_001085792.1.86508 WP_001085792.1.86523 WP_001085792.1.86526 WP_001085792.1.86531 WP_001085792.1.86542 WP_001085792.1.86606 WP_001085792.1.86628 WP_001085792.1.8663 WP_001085792.1.86664 WP_001085792.1.86704 WP_001085792.1.86706 WP_001085792.1.86736 WP_001085792.1.86745 WP_001085792.1.86779 WP_001085792.1.86792 WP_001085792.1.86793 WP_001085792.1.86795 WP_001085792.1.8681 WP_001085792.1.86838 WP_001085792.1.86881 WP_001085792.1.8690 WP_001085792.1.86910 WP_001085792.1.86911 WP_001085792.1.86916 WP_001085792.1.86940 WP_001085792.1.86942 WP_001085792.1.86961 WP_001085792.1.86968 WP_001085792.1.86977 WP_001085792.1.8699 WP_001085792.1.86999 WP_001085792.1.87021 WP_001085792.1.87042 WP_001085792.1.87057 WP_001085792.1.87072 WP_001085792.1.87090 WP_001085792.1.87096 WP_001085792.1.87097 WP_001085792.1.87100 WP_001085792.1.87110 WP_001085792.1.87119 WP_001085792.1.8712 WP_001085792.1.87122 WP_001085792.1.87133 WP_001085792.1.87137 WP_001085792.1.87141 WP_001085792.1.87168 WP_001085792.1.87175 WP_001085792.1.87190 WP_001085792.1.87194 WP_001085792.1.8720 WP_001085792.1.87204 WP_001085792.1.87221 WP_001085792.1.87236 WP_001085792.1.87260 WP_001085792.1.87261 WP_001085792.1.87264 WP_001085792.1.87272 WP_001085792.1.87285 WP_001085792.1.87290 WP_001085792.1.87296 WP_001085792.1.87308 WP_001085792.1.8731 WP_001085792.1.87363 WP_001085792.1.87372 WP_001085792.1.87388 WP_001085792.1.87396 WP_001085792.1.87457 WP_001085792.1.87461 WP_001085792.1.87466 WP_001085792.1.87486 WP_001085792.1.87497 WP_001085792.1.875 WP_001085792.1.87508 WP_001085792.1.87511 WP_001085792.1.87515 WP_001085792.1.87520 WP_001085792.1.8753 WP_001085792.1.87534 WP_001085792.1.87543 WP_001085792.1.8757 WP_001085792.1.87579 WP_001085792.1.87593 WP_001085792.1.87595 WP_001085792.1.87601 WP_001085792.1.87636 WP_001085792.1.8764 WP_001085792.1.87647 WP_001085792.1.87682 WP_001085792.1.8770 WP_001085792.1.87703 WP_001085792.1.87710 WP_001085792.1.87718 WP_001085792.1.87734 WP_001085792.1.87735 WP_001085792.1.87745 WP_001085792.1.87748 WP_001085792.1.87764 WP_001085792.1.87782 WP_001085792.1.8779 WP_001085792.1.87808 WP_001085792.1.87828 WP_001085792.1.87838 WP_001085792.1.87841 WP_001085792.1.87843 WP_001085792.1.87854 WP_001085792.1.87865 WP_001085792.1.87879 WP_001085792.1.8791 WP_001085792.1.87912 WP_001085792.1.87937 WP_001085792.1.87948 WP_001085792.1.87963 WP_001085792.1.87964 WP_001085792.1.87967 WP_001085792.1.87972 WP_001085792.1.87985 WP_001085792.1.87995 WP_001085792.1.88013 WP_001085792.1.88024 WP_001085792.1.88032 WP_001085792.1.88061 WP_001085792.1.88101 WP_001085792.1.88114 WP_001085792.1.88150 WP_001085792.1.88169 WP_001085792.1.88212 WP_001085792.1.88240 WP_001085792.1.88270 WP_001085792.1.88309 WP_001085792.1.88311 WP_001085792.1.88317 WP_001085792.1.88319 WP_001085792.1.88339 WP_001085792.1.88351 WP_001085792.1.88363 WP_001085792.1.88367 WP_001085792.1.88371 WP_001085792.1.88373 WP_001085792.1.88375 WP_001085792.1.88380 WP_001085792.1.88392 WP_001085792.1.88418 WP_001085792.1.88430 WP_001085792.1.88440 WP_001085792.1.88445 WP_001085792.1.88449 WP_001085792.1.88455 WP_001085792.1.8847 WP_001085792.1.88473 WP_001085792.1.88478 WP_001085792.1.88480 WP_001085792.1.88490 WP_001085792.1.88498 WP_001085792.1.88504 WP_001085792.1.88518 WP_001085792.1.88536 WP_001085792.1.88555 WP_001085792.1.88558 WP_001085792.1.88560 WP_001085792.1.88563 WP_001085792.1.8857 WP_001085792.1.88572 WP_001085792.1.88580 WP_001085792.1.88583 WP_001085792.1.88585 WP_001085792.1.8859 WP_001085792.1.88599 WP_001085792.1.88600 WP_001085792.1.88614 WP_001085792.1.88623 WP_001085792.1.88636 WP_001085792.1.88638 WP_001085792.1.88642 WP_001085792.1.88671 WP_001085792.1.88694 WP_001085792.1.88696 WP_001085792.1.8872 WP_001085792.1.88738 WP_001085792.1.88739 WP_001085792.1.88753 WP_001085792.1.88761 WP_001085792.1.8877 WP_001085792.1.88771 WP_001085792.1.88781 WP_001085792.1.88805 WP_001085792.1.88843 WP_001085792.1.88856 WP_001085792.1.88859 WP_001085792.1.8886 WP_001085792.1.88878 WP_001085792.1.8888 WP_001085792.1.88881 WP_001085792.1.88897 WP_001085792.1.88922 WP_001085792.1.88934 WP_001085792.1.88954 WP_001085792.1.88959 WP_001085792.1.88962 WP_001085792.1.88987 WP_001085792.1.8899 WP_001085792.1.8900 WP_001085792.1.89012 WP_001085792.1.89024 WP_001085792.1.89027 WP_001085792.1.89036 WP_001085792.1.8904 WP_001085792.1.89070 WP_001085792.1.89086 WP_001085792.1.89108 WP_001085792.1.8913 WP_001085792.1.89133 WP_001085792.1.89139 WP_001085792.1.89164 WP_001085792.1.8918 WP_001085792.1.89181 WP_001085792.1.89184 WP_001085792.1.89194 WP_001085792.1.89195 WP_001085792.1.89204 WP_001085792.1.89216 WP_001085792.1.89235 WP_001085792.1.8924 WP_001085792.1.89258 WP_001085792.1.89262 WP_001085792.1.89284 WP_001085792.1.8929 WP_001085792.1.89290 WP_001085792.1.89348 WP_001085792.1.89372 WP_001085792.1.89390 WP_001085792.1.89404 WP_001085792.1.89433 WP_001085792.1.89439 WP_001085792.1.89476 WP_001085792.1.8950 WP_001085792.1.89516 WP_001085792.1.89537 WP_001085792.1.89544 WP_001085792.1.89545 WP_001085792.1.89556 WP_001085792.1.89557 WP_001085792.1.89559 WP_001085792.1.89594 WP_001085792.1.89603 WP_001085792.1.89655 WP_001085792.1.89672 WP_001085792.1.89678 WP_001085792.1.89686 WP_001085792.1.897 WP_001085792.1.89717 WP_001085792.1.89726 WP_001085792.1.89730 WP_001085792.1.89738 WP_001085792.1.89754 WP_001085792.1.89779 WP_001085792.1.89794 WP_001085792.1.89799 WP_001085792.1.898 WP_001085792.1.89857 WP_001085792.1.8986 WP_001085792.1.89863 WP_001085792.1.89883 WP_001085792.1.8990 WP_001085792.1.89924 WP_001085792.1.89928 WP_001085792.1.89933 WP_001085792.1.89935 WP_001085792.1.89949 WP_001085792.1.89950 WP_001085792.1.89960 WP_001085792.1.90005 WP_001085792.1.90018 WP_001085792.1.90038 WP_001085792.1.90046 WP_001085792.1.90055 WP_001085792.1.90069 WP_001085792.1.90091 WP_001085792.1.90095 WP_001085792.1.90112 WP_001085792.1.90131 WP_001085792.1.90145 WP_001085792.1.90148 WP_001085792.1.90161 WP_001085792.1.90173 WP_001085792.1.90174 WP_001085792.1.90180 WP_001085792.1.90215 WP_001085792.1.90217 WP_001085792.1.9022 WP_001085792.1.90232 WP_001085792.1.90239 WP_001085792.1.90243 WP_001085792.1.90246 WP_001085792.1.90253 WP_001085792.1.90263 WP_001085792.1.90269 WP_001085792.1.90276 WP_001085792.1.9030 WP_001085792.1.90307 WP_001085792.1.90331 WP_001085792.1.90345 WP_001085792.1.90367 WP_001085792.1.90370 WP_001085792.1.90386 WP_001085792.1.90432 WP_001085792.1.90447 WP_001085792.1.90454 WP_001085792.1.90473 WP_001085792.1.90475 WP_001085792.1.90479 WP_001085792.1.90488 WP_001085792.1.90506 WP_001085792.1.90514 WP_001085792.1.90517 WP_001085792.1.90533 WP_001085792.1.90544 WP_001085792.1.9055 WP_001085792.1.90554 WP_001085792.1.90556 WP_001085792.1.90604 WP_001085792.1.90647 WP_001085792.1.90660 WP_001085792.1.90669 WP_001085792.1.90683 WP_001085792.1.90698 WP_001085792.1.9071 WP_001085792.1.90717 WP_001085792.1.90726 WP_001085792.1.90728 WP_001085792.1.90738 WP_001085792.1.90740 WP_001085792.1.90745 WP_001085792.1.90757 WP_001085792.1.9076 WP_001085792.1.90801 WP_001085792.1.90804 WP_001085792.1.90818 WP_001085792.1.90820 WP_001085792.1.90861 WP_001085792.1.90896 WP_001085792.1.90903 WP_001085792.1.90923 WP_001085792.1.90994 WP_001085792.1.9100 WP_001085792.1.91005 WP_001085792.1.91011 WP_001085792.1.91019 WP_001085792.1.91054 WP_001085792.1.91087 WP_001085792.1.91124 WP_001085792.1.91126 WP_001085792.1.9114 WP_001085792.1.91150 WP_001085792.1.91158 WP_001085792.1.91177 WP_001085792.1.91184 WP_001085792.1.912 WP_001085792.1.9122 WP_001085792.1.91233 WP_001085792.1.91246 WP_001085792.1.91252 WP_001085792.1.91258 WP_001085792.1.91279 WP_001085792.1.91280 WP_001085792.1.91297 WP_001085792.1.91300 WP_001085792.1.91332 WP_001085792.1.91346 WP_001085792.1.91357 WP_001085792.1.91364 WP_001085792.1.91365 WP_001085792.1.91371 WP_001085792.1.91382 WP_001085792.1.9140 WP_001085792.1.91420 WP_001085792.1.91427 WP_001085792.1.91447 WP_001085792.1.91486 WP_001085792.1.91487 WP_001085792.1.91500 WP_001085792.1.91525 WP_001085792.1.9153 WP_001085792.1.91530 WP_001085792.1.9155 WP_001085792.1.91559 WP_001085792.1.91573 WP_001085792.1.91581 WP_001085792.1.91586 WP_001085792.1.91587 WP_001085792.1.91611 WP_001085792.1.91624 WP_001085792.1.91629 WP_001085792.1.91634 WP_001085792.1.91639 WP_001085792.1.91660 WP_001085792.1.91670 WP_001085792.1.917 WP_001085792.1.91704 WP_001085792.1.91745 WP_001085792.1.91746 WP_001085792.1.91749 WP_001085792.1.91771 WP_001085792.1.91791 WP_001085792.1.91800 WP_001085792.1.91816 WP_001085792.1.91829 WP_001085792.1.91848 WP_001085792.1.91895 WP_001085792.1.91909 WP_001085792.1.91918 WP_001085792.1.91919 WP_001085792.1.91928 WP_001085792.1.91950 WP_001085792.1.91969 WP_001085792.1.92 WP_001085792.1.92055 WP_001085792.1.92080 WP_001085792.1.92115 WP_001085792.1.92125 WP_001085792.1.92133 WP_001085792.1.92140 WP_001085792.1.92143 WP_001085792.1.92147 WP_001085792.1.92164 WP_001085792.1.92169 WP_001085792.1.92173 WP_001085792.1.92185 WP_001085792.1.92186 WP_001085792.1.92196 WP_001085792.1.92199 WP_001085792.1.92212 WP_001085792.1.92227 WP_001085792.1.92228 WP_001085792.1.9224 WP_001085792.1.92244 WP_001085792.1.92249 WP_001085792.1.92253 WP_001085792.1.92254 WP_001085792.1.92259 WP_001085792.1.923 WP_001085792.1.92303 WP_001085792.1.9234 WP_001085792.1.92340 WP_001085792.1.9237 WP_001085792.1.9239 WP_001085792.1.92391 WP_001085792.1.92398 WP_001085792.1.92405 WP_001085792.1.92415 WP_001085792.1.92425 WP_001085792.1.92436 WP_001085792.1.92442 WP_001085792.1.9247 WP_001085792.1.92479 WP_001085792.1.92488 WP_001085792.1.92497 WP_001085792.1.92500 WP_001085792.1.92512 WP_001085792.1.92520 WP_001085792.1.92534 WP_001085792.1.92544 WP_001085792.1.92546 WP_001085792.1.92565 WP_001085792.1.92602 WP_001085792.1.92607 WP_001085792.1.92667 WP_001085792.1.92674 WP_001085792.1.92679 WP_001085792.1.92688 WP_001085792.1.92691 WP_001085792.1.92718 WP_001085792.1.92723 WP_001085792.1.92735 WP_001085792.1.92741 WP_001085792.1.92765 WP_001085792.1.92773 WP_001085792.1.92789 WP_001085792.1.92795 WP_001085792.1.92805 WP_001085792.1.92848 WP_001085792.1.92849 WP_001085792.1.9286 WP_001085792.1.92862 WP_001085792.1.92864 WP_001085792.1.92897 WP_001085792.1.92918 WP_001085792.1.9293 WP_001085792.1.92937 WP_001085792.1.92950 WP_001085792.1.92960 WP_001085792.1.92965 WP_001085792.1.9298 WP_001085792.1.92997 WP_001085792.1.93010 WP_001085792.1.93041 WP_001085792.1.93047 WP_001085792.1.9305 WP_001085792.1.93068 WP_001085792.1.93071 WP_001085792.1.93074 WP_001085792.1.93125 WP_001085792.1.93141 WP_001085792.1.93147 WP_001085792.1.93163 WP_001085792.1.93176 WP_001085792.1.93186 WP_001085792.1.93191 WP_001085792.1.93197 WP_001085792.1.93198 WP_001085792.1.93207 WP_001085792.1.93211 WP_001085792.1.93224 WP_001085792.1.93231 WP_001085792.1.93235 WP_001085792.1.93237 WP_001085792.1.93243 WP_001085792.1.93254 WP_001085792.1.93260 WP_001085792.1.93263 WP_001085792.1.93272 WP_001085792.1.93296 WP_001085792.1.9330 WP_001085792.1.93300 WP_001085792.1.93316 WP_001085792.1.93336 WP_001085792.1.93354 WP_001085792.1.93374 WP_001085792.1.93378 WP_001085792.1.93416 WP_001085792.1.93435 WP_001085792.1.93438 WP_001085792.1.93444 WP_001085792.1.93471 WP_001085792.1.93492 WP_001085792.1.93514 WP_001085792.1.9352 WP_001085792.1.93538 WP_001085792.1.9354 WP_001085792.1.93567 WP_001085792.1.93579 WP_001085792.1.9358 WP_001085792.1.93590 WP_001085792.1.93613 WP_001085792.1.93647 WP_001085792.1.93658 WP_001085792.1.93669 WP_001085792.1.93678 WP_001085792.1.93690 WP_001085792.1.9370 WP_001085792.1.93708 WP_001085792.1.93710 WP_001085792.1.93722 WP_001085792.1.93736 WP_001085792.1.93738 WP_001085792.1.93762 WP_001085792.1.93769 WP_001085792.1.93775 WP_001085792.1.93787 WP_001085792.1.9387 WP_001085792.1.93882 WP_001085792.1.93883 WP_001085792.1.93890 WP_001085792.1.93891 WP_001085792.1.9392 WP_001085792.1.93975 WP_001085792.1.93976 WP_001085792.1.9398 WP_001085792.1.93981 WP_001085792.1.94 WP_001085792.1.94053 WP_001085792.1.94074 WP_001085792.1.9408 WP_001085792.1.94080 WP_001085792.1.94082 WP_001085792.1.94087 WP_001085792.1.94093 WP_001085792.1.94096 WP_001085792.1.9411 WP_001085792.1.94119 WP_001085792.1.94122 WP_001085792.1.94123 WP_001085792.1.94130 WP_001085792.1.94165 WP_001085792.1.94172 WP_001085792.1.94182 WP_001085792.1.94209 WP_001085792.1.94229 WP_001085792.1.94242 WP_001085792.1.94245 WP_001085792.1.94248 WP_001085792.1.94268 WP_001085792.1.94287 WP_001085792.1.94293 WP_001085792.1.94294 WP_001085792.1.94319 WP_001085792.1.94320 WP_001085792.1.94324 WP_001085792.1.94325 WP_001085792.1.94335 WP_001085792.1.94337 WP_001085792.1.94340 WP_001085792.1.94341 WP_001085792.1.9437 WP_001085792.1.94374 WP_001085792.1.94375 WP_001085792.1.94376 WP_001085792.1.94389 WP_001085792.1.94407 WP_001085792.1.94414 WP_001085792.1.94423 WP_001085792.1.94484 WP_001085792.1.94505 WP_001085792.1.94530 WP_001085792.1.94536 WP_001085792.1.9455 WP_001085792.1.94550 WP_001085792.1.94576 WP_001085792.1.94625 WP_001085792.1.9464 WP_001085792.1.94684 WP_001085792.1.94688 WP_001085792.1.947 WP_001085792.1.94719 WP_001085792.1.94733 WP_001085792.1.94741 WP_001085792.1.94789 WP_001085792.1.94797 WP_001085792.1.94805 WP_001085792.1.94825 WP_001085792.1.94838 WP_001085792.1.94844 WP_001085792.1.94845 WP_001085792.1.9485 WP_001085792.1.94857 WP_001085792.1.94866 WP_001085792.1.94969 WP_001085792.1.9497 WP_001085792.1.94980 WP_001085792.1.94989 WP_001085792.1.94992 WP_001085792.1.94999 WP_001085792.1.95002 WP_001085792.1.95008 WP_001085792.1.95023 WP_001085792.1.95029 WP_001085792.1.95033 WP_001085792.1.95038 WP_001085792.1.95075 WP_001085792.1.95077 WP_001085792.1.9510 WP_001085792.1.95120 WP_001085792.1.95154 WP_001085792.1.95156 WP_001085792.1.95193 WP_001085792.1.95210 WP_001085792.1.95263 WP_001085792.1.95294 WP_001085792.1.95307 WP_001085792.1.95318 WP_001085792.1.95327 WP_001085792.1.95342 WP_001085792.1.95361 WP_001085792.1.95372 WP_001085792.1.9538 WP_001085792.1.95386 WP_001085792.1.95415 WP_001085792.1.9544 WP_001085792.1.95442 WP_001085792.1.95476 WP_001085792.1.95494 WP_001085792.1.95495 WP_001085792.1.95505 WP_001085792.1.95512 WP_001085792.1.95519 WP_001085792.1.95522 WP_001085792.1.95535 WP_001085792.1.95537 WP_001085792.1.95550 WP_001085792.1.95552 WP_001085792.1.95560 WP_001085792.1.9557 WP_001085792.1.95581 WP_001085792.1.95603 WP_001085792.1.9563 WP_001085792.1.95631 WP_001085792.1.95639 WP_001085792.1.95640 WP_001085792.1.95681 WP_001085792.1.95683 WP_001085792.1.95699 WP_001085792.1.95704 WP_001085792.1.95713 WP_001085792.1.95714 WP_001085792.1.95737 WP_001085792.1.95760 WP_001085792.1.95780 WP_001085792.1.95804 WP_001085792.1.95806 WP_001085792.1.95832 WP_001085792.1.95877 WP_001085792.1.95885 WP_001085792.1.959 WP_001085792.1.95914 WP_001085792.1.95918 WP_001085792.1.95943 WP_001085792.1.95962 WP_001085792.1.95986 WP_001085792.1.95997 WP_001085792.1.96014 WP_001085792.1.96022 WP_001085792.1.96030 WP_001085792.1.96056 WP_001085792.1.96057 WP_001085792.1.96067 WP_001085792.1.96075 WP_001085792.1.96105 WP_001085792.1.96135 WP_001085792.1.96148 WP_001085792.1.96160 WP_001085792.1.96163 WP_001085792.1.96165 WP_001085792.1.9617 WP_001085792.1.96200 WP_001085792.1.96209 WP_001085792.1.96218 WP_001085792.1.96228 WP_001085792.1.96255 WP_001085792.1.96261 WP_001085792.1.96271 WP_001085792.1.96280 WP_001085792.1.96283 WP_001085792.1.96297 WP_001085792.1.96305 WP_001085792.1.96312 WP_001085792.1.96314 WP_001085792.1.96316 WP_001085792.1.96322 WP_001085792.1.96334 WP_001085792.1.96362 WP_001085792.1.96364 WP_001085792.1.96368 WP_001085792.1.96412 WP_001085792.1.96424 WP_001085792.1.96433 WP_001085792.1.96468 WP_001085792.1.96472 WP_001085792.1.96477 WP_001085792.1.96489 WP_001085792.1.9650 WP_001085792.1.96535 WP_001085792.1.96538 WP_001085792.1.96548 WP_001085792.1.96554 WP_001085792.1.96566 WP_001085792.1.96568 WP_001085792.1.96577 WP_001085792.1.96578 WP_001085792.1.96591 WP_001085792.1.96603 WP_001085792.1.96613 WP_001085792.1.96628 WP_001085792.1.96634 WP_001085792.1.96637 WP_001085792.1.96638 WP_001085792.1.96646 WP_001085792.1.96654 WP_001085792.1.96663 WP_001085792.1.96678 WP_001085792.1.96682 WP_001085792.1.96688 WP_001085792.1.96699 WP_001085792.1.96705 WP_001085792.1.96718 WP_001085792.1.96727 WP_001085792.1.9675 WP_001085792.1.96770 WP_001085792.1.96780 WP_001085792.1.96804 WP_001085792.1.96836 WP_001085792.1.96854 WP_001085792.1.96855 WP_001085792.1.96859 WP_001085792.1.96866 WP_001085792.1.96882 WP_001085792.1.96892 WP_001085792.1.96895 WP_001085792.1.96918 WP_001085792.1.9692 WP_001085792.1.96922 WP_001085792.1.96928 WP_001085792.1.9695 WP_001085792.1.96956 WP_001085792.1.96965 WP_001085792.1.96969 WP_001085792.1.96970 WP_001085792.1.96985 WP_001085792.1.96997 WP_001085792.1.97000 WP_001085792.1.97001 WP_001085792.1.97007 WP_001085792.1.97014 WP_001085792.1.97017 WP_001085792.1.97019 WP_001085792.1.97029 WP_001085792.1.97033 WP_001085792.1.97034 WP_001085792.1.97072 WP_001085792.1.97117 WP_001085792.1.97138 WP_001085792.1.97139 WP_001085792.1.97141 WP_001085792.1.97146 WP_001085792.1.97161 WP_001085792.1.97164 WP_001085792.1.97191 WP_001085792.1.97205 WP_001085792.1.97228 WP_001085792.1.97230 WP_001085792.1.97234 WP_001085792.1.97241 WP_001085792.1.9725 WP_001085792.1.97267 WP_001085792.1.97295 WP_001085792.1.97302 WP_001085792.1.97312 WP_001085792.1.97336 WP_001085792.1.97348 WP_001085792.1.97352 WP_001085792.1.97355 WP_001085792.1.97367 WP_001085792.1.9737 WP_001085792.1.97392 WP_001085792.1.97409 WP_001085792.1.97427 WP_001085792.1.9743 WP_001085792.1.97444 WP_001085792.1.97450 WP_001085792.1.97456 WP_001085792.1.97460 WP_001085792.1.97468 WP_001085792.1.9748 WP_001085792.1.97484 WP_001085792.1.97494 WP_001085792.1.97530 WP_001085792.1.97531 WP_001085792.1.97536 WP_001085792.1.97537 WP_001085792.1.97574 WP_001085792.1.97575 WP_001085792.1.97576 WP_001085792.1.9758 WP_001085792.1.97585 WP_001085792.1.97590 WP_001085792.1.97627 WP_001085792.1.97641 WP_001085792.1.97664 WP_001085792.1.97687 WP_001085792.1.97696 WP_001085792.1.97699 WP_001085792.1.97717 WP_001085792.1.97729 WP_001085792.1.97731 WP_001085792.1.97739 WP_001085792.1.97742 WP_001085792.1.97744 WP_001085792.1.97746 WP_001085792.1.97758 WP_001085792.1.97762 WP_001085792.1.97763 WP_001085792.1.97786 WP_001085792.1.97827 WP_001085792.1.97835 WP_001085792.1.9788 WP_001085792.1.9789 WP_001085792.1.97899 WP_001085792.1.97935 WP_001085792.1.97953 WP_001085792.1.97955 WP_001085792.1.97967 WP_001085792.1.97974 WP_001085792.1.97997 WP_001085792.1.97999 WP_001085792.1.98011 WP_001085792.1.98033 WP_001085792.1.98051 WP_001085792.1.98054 WP_001085792.1.98058 WP_001085792.1.98073 WP_001085792.1.98131 WP_001085792.1.98161 WP_001085792.1.98174 WP_001085792.1.98179 WP_001085792.1.98191 WP_001085792.1.98195 WP_001085792.1.98233 WP_001085792.1.98242 WP_001085792.1.98248 WP_001085792.1.98249 WP_001085792.1.98281 WP_001085792.1.98295 WP_001085792.1.98307 WP_001085792.1.98322 WP_001085792.1.98328 WP_001085792.1.98352 WP_001085792.1.98353 WP_001085792.1.98360 WP_001085792.1.98361 WP_001085792.1.98366 WP_001085792.1.98379 WP_001085792.1.98387 WP_001085792.1.98409 WP_001085792.1.98411 WP_001085792.1.98415 WP_001085792.1.98419 WP_001085792.1.98425 WP_001085792.1.98456 WP_001085792.1.98497 WP_001085792.1.98510 WP_001085792.1.98546 WP_001085792.1.98548 WP_001085792.1.98552 WP_001085792.1.98559 WP_001085792.1.98585 WP_001085792.1.986 WP_001085792.1.98609 WP_001085792.1.98655 WP_001085792.1.98659 WP_001085792.1.98667 WP_001085792.1.98706 WP_001085792.1.98710 WP_001085792.1.9872 WP_001085792.1.98723 WP_001085792.1.98730 WP_001085792.1.98734 WP_001085792.1.98741 WP_001085792.1.98750 WP_001085792.1.98767 WP_001085792.1.98786 WP_001085792.1.98797 WP_001085792.1.98805 WP_001085792.1.98807 WP_001085792.1.98821 WP_001085792.1.98837 WP_001085792.1.98842 WP_001085792.1.98858 WP_001085792.1.98874 WP_001085792.1.98880 WP_001085792.1.98883 WP_001085792.1.98894 WP_001085792.1.98912 WP_001085792.1.98967 WP_001085792.1.98978 WP_001085792.1.98981 WP_001085792.1.98985 WP_001085792.1.99009 WP_001085792.1.99025 WP_001085792.1.99027 WP_001085792.1.9903 WP_001085792.1.99081 WP_001085792.1.991 WP_001085792.1.9910 WP_001085792.1.99102 WP_001085792.1.9912 WP_001085792.1.99136 WP_001085792.1.99155 WP_001085792.1.99171 WP_001085792.1.99174 WP_001085792.1.99207 WP_001085792.1.99217 WP_001085792.1.99228 WP_001085792.1.99237 WP_001085792.1.99249 WP_001085792.1.99280 WP_001085792.1.99283 WP_001085792.1.99308 WP_001085792.1.99311 WP_001085792.1.99331 WP_001085792.1.99359 WP_001085792.1.9936 WP_001085792.1.99405 WP_001085792.1.99414 WP_001085792.1.99418 WP_001085792.1.99430 WP_001085792.1.99492 WP_001085792.1.99494 WP_001085792.1.99509 WP_001085792.1.99519 WP_001085792.1.99523 WP_001085792.1.99524 WP_001085792.1.99536 WP_001085792.1.99538 WP_001085792.1.99564 WP_001085792.1.99569 WP_001085792.1.9960 WP_001085792.1.99631 WP_001085792.1.9965 WP_001085792.1.99683 WP_001085792.1.99686 WP_001085792.1.99700 WP_001085792.1.99714 WP_001085792.1.9974 WP_001085792.1.99802 WP_001085792.1.99830 WP_001085792.1.99849 WP_001085792.1.99850 WP_001085792.1.99859 WP_001085792.1.99860 WP_001085792.1.99862 WP_001085792.1.9987 WP_001085792.1.99884 WP_001085792.1.99888 WP_001085792.1.99901 WP_001085792.1.99926 WP_001085792.1.99934 WP_001085792.1.99954 WP_001085792.1.99955 WP_001085792.1.99956 WP_001085792.1.99979 WP_001085792.1.99984 WP_001085792.1.99985 WP_001085792.1.99999 YP_499091.1.76163 gi|384863866|ref|YP_005749225.1| gi|545634020|ref|YP_008584590.1| gi|87161133|ref|YP_493225.1| gi|387142227|ref|YP_005730620.1| gi|554643334|ref|YP_008715125.1| gi|49482767|ref|YP_039991.1| gi|379013819|ref|YP_005290055.1| gi|384549401|ref|YP_005738653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]