SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402550900|ref|YP_006599620.1| from Mycoplasma genitalium M2321

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|402550900|ref|YP_006599620.1|
Domain Number - Region: 288-389
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000157
Family IMD domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|402550900|ref|YP_006599620.1|
Sequence length 650
Comment hypothetical protein CM9_00535 [Mycoplasma genitalium M2321]
Sequence
MKTQKISLRFKALLLSLFSAAVTITIFALPIFANNGSKTDLGLLSKNSADFLGSSKRSLA
GFDTPFSPDNLQYLEKETDYDQNFKNFTEKFKDEKITNDQLDIVDIYNLFSGFHKSVKNT
VDLMSQLQKQVEAANAIFPVDDAFVKLPKVPTELFKLVDDNVFPKLNPKGLNISDNIAAL
FERYNLKSIELKNFDLAFLRKADVIIKDRVRYNFEMQMQFQTVYVGGGNTVINLDFTLKA
QTVNFANLQDLQNTFVKVGNDLSTQLFWIPTVNKLTDNAGNDLTHIAKTVIGESFFQTNV
NLAKSVIEYDKVQPLVKQAFEERVLTPFKKEREAAKKAYEEEQRRLEEERKRQLEELRRK
EAEAKRKAEEAKRNQEKARREREAYEKSFNSFKDFKSYWLTQGKNVAKKAELIDVLKTVI
ATPAYRNKTFSLLIKGFASGVERYFNANKNDKELKKLAFGEKGIQFPRADAGIDGLYMSN
FLRHELTSKAKFSLNLKDIKVENTVEDTQLYWKDNGIHLKQANPYKFNLNIKIKYNGWYN
VHWWNWLPAKILGIPTDWSGEMNLTFVVNGDLSEIVDKHDYPGTFFQFTDKNELLFTLAV
REQIKVDNNHFMGLLKSQNLHNLQLASGATKPPVVDLASYFHFVLLTEKS
Download sequence
Identical sequences WP_014893931.1.95915 gi|402550900|ref|YP_006599620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]