SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162145864|ref|YP_001600322.1| from Gluconacetobacter diazotrophicus PAl 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162145864|ref|YP_001600322.1|
Domain Number 1 Region: 394-593
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.14e-62
Family Pyruvate oxidase and decarboxylase PP module 0.00000942
Further Details:      
 
Domain Number 2 Region: 20-205
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.02e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000035
Further Details:      
 
Domain Number 3 Region: 206-378
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.97e-58
Family Pyruvate oxidase and decarboxylase, middle domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162145864|ref|YP_001600322.1|
Sequence length 608
Comment acetolactate synthase isozyme III large subunit [Gluconacetobacter diazotrophicus PAl 5]
Sequence
MNATPNLNDLKPTARAQAGDVVLSGAEVLLRVLADQGVEVVFGYPGGAVLPIYDALFRQN
AIRHVLVRHEQAAVHAAEAYARSTGKVGVVLVTSGPGATNAVTGLVDALMDSIPVVCFSG
QVGVPLIGTDAFQEADTTGITRPATKHNYLVRRPGDLARVVHEAFHIARSGRPGPVLVDL
PKNLTVGPAPYQPASRAPHPSYRPRTEPDREAVSRAVAAMKGAKRPLFYTGGGIINSGPG
AGESLGRLVRMTGFPCTSTLMGLGAFPTTDRQFLGMLGMHGTYEANLATHGCDVLIALGA
RFDDRVTGRLDAFSPDSFKIHADIDPSQINKIVQVDVPVLGDAGRVIDMMIEEWERQNGA
PDKAALAQWWQQIDAWRGIRSLHFTQDMTPSAIIRPQHAVRRLYELAMETGRDTYVSTEV
GQHQMWAAQHFQFDRPNRWLTSGGLGTMGYGLPAAVGAQIAHPDALVIDIAGEASTLMNI
QELGTIAQYRLPVKLFILNNQYMGMVRQWQELLHGSRYSESYSAALPDFVRLAESFHARG
MRATCVGELDDVIRAMLAEPGAVVADICVAQDENVYPMIPSGAAHNQMLLGPEQDGEVTV
SAEGRMLV
Download sequence
Identical sequences A9GZI8
272568.GDI_0022 gi|162145864|ref|YP_001600322.1| gi|162145864|ref|YP_001600322.1| WP_012222273.1.42434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]