SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162146004|ref|YP_001600462.1| from Gluconacetobacter diazotrophicus PAl 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162146004|ref|YP_001600462.1|
Domain Number 1 Region: 390-535
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.57e-56
Family Pyruvate oxidase and decarboxylase PP module 0.00000129
Further Details:      
 
Domain Number 2 Region: 3-175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.89e-41
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000439
Further Details:      
 
Domain Number 3 Region: 166-335
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.26e-29
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162146004|ref|YP_001600462.1|
Sequence length 558
Comment pyruvate decarboxylase [Gluconacetobacter diazotrophicus PAl 5]
Sequence
MTYTVGRYLADRLAQIGLKHHFAVAGDYNLVLLDQLLLNTDMQQIYCSNELNCGFSAEGY
ARANGAAAAIVTFSVGALSAFNALGGAYAENLPVILISGAPNANDHGTGHILHHTLGTTD
YGYQLEMARHITCAAESIVAAEDAPAKIDHVIRTALREKKPAYLEIACNVAGAPCVRPGG
IDALLSPPAPDEASLKAAVDAALAFIEQRGSVTMLVGSRIRAAGAQAQAVALADALGCAV
TTMAAAKSFFPEDHPGYRGHYWGEVSSPGAQQAVEGADGVICLAPVFNDYATVGWSAWPK
GDNVMLVERHAVTVGGVAYAGIDMRDFLTRLAAHTVRRDATARGGAYVTPQTPAAAPTAP
LNNAEMARQIGALLTPRTTLTAETGDSWFNAVRMKLPHGARVELEMQWGHIGWSVPAAFG
NALAAPERQHVLMVGDGSFQLTAQEVAQMIRHDLPVIIFLINNHGYTIEVMIHDGPYNNV
KNWDYAGLMEVFNAGEGNGLGLRARTGGELAAAIEQARANRNGPTLIECTLDRDDCTQEL
VTWGKRVAAANARPPRAG
Download sequence
Identical sequences A9H275
4cok_A 4cok_B gi|162146004|ref|YP_001600462.1| gi|162146004|ref|YP_001600462.1| 272568.GDI_0172 WP_012222411.1.42434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]