SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162146190|ref|YP_001600649.1| from Gluconacetobacter diazotrophicus PAl 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162146190|ref|YP_001600649.1|
Domain Number 1 Region: 402-614
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.58e-50
Family Pyruvate oxidase and decarboxylase PP module 0.0016
Further Details:      
 
Domain Number 2 Region: 181-380
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.27e-37
Family Pyruvate oxidase and decarboxylase, middle domain 0.0037
Further Details:      
 
Domain Number 3 Region: 2-211
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-32
Family Pyruvate oxidase and decarboxylase Pyr module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162146190|ref|YP_001600649.1|
Sequence length 622
Comment acetolactate synthase large subunit [Gluconacetobacter diazotrophicus PAl 5]
Sequence
MNTIRLTMAQALVRAMCAQKTELDGQIVPFFGGVWAIFGHGNVAGMGEALHAQRDDITTF
RAHNEQGMVHAATAYAKAQRRRRAMACTTSIGPGALNMVTGAAVAHVNRLPVLLLPGDVF
ANRVPDPVLQQVEDFGDGTITANDAFRPVSRYFDRITRPEQLIPAFARAMAVLTDPAECG
PATLALCQDVQAEAFDYPEHVFAERIHRPRRPAPDERDLHDAAGIIRAARRPFVVVGGGV
PYSGAGEQVAAFCAARGIPAGETQAGKSALPATLAMNMGGVGVSGTSAANTMAAQADVVI
AIGTRLQDFTTGSWGLFQNPDMRIVGLNVQAFDAMKHEAQPLLADARVGLAALDAHLGDW
RAEGDWTGMAERARAEWLEISARCLAASSASAPPSGALPSDAQVIGAVRRAGTPTDVVVC
AAGGLPAELQKHWRADRPGGYHMEYGFSCMGYELAGALGVKMADPSREVIVMVGDGSYLM
LNSEIATSVMLGFRLTIVVLDNHGYGCINRLQQACGGAPFNNLWKNSMHMHEFPAIDFAA
HARSLGADAVKVSGLAALEDAVRQARDAARTTVIVIDTDPMPTTRDGGAWWDVAVPEISA
RPGVNQARAEYECKRNSQRIGN
Download sequence
Identical sequences A9H5A3
gi|162146190|ref|YP_001600649.1| 272568.GDI_0362 WP_012222658.1.42434 gi|162146190|ref|YP_001600649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]