SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162146546|ref|YP_001601005.1| from Gluconacetobacter diazotrophicus PAl 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162146546|ref|YP_001601005.1|
Domain Number 1 Region: 200-334
Classification Level Classification E-value
Superfamily CBS-domain pair 1.53e-25
Family CBS-domain pair 0.0039
Further Details:      
 
Domain Number 2 Region: 346-423
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.2e-19
Family CorC/HlyC domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162146546|ref|YP_001601005.1|
Sequence length 428
Comment hypothetical protein GDI_0723 [Gluconacetobacter diazotrophicus PAl 5]
Sequence
MIAPLVVIFLLVLINGIFAMGELALISARRTRLMIMHRSGVKGAERALRLAEDPQSFLPT
VQVGITLVSILEGTFGGTQIEGYLTPWLARFPALRPFAAELSMTVVVVAITSLMLVLGEL
VPKQLALRHPEIVAARLSLPLEGLARVTRPAVWLLGRSSNLVLRLMGVGAMTREALTEEE
LKAYIAEGAQSGVLEQEERDMIERLLRLADRPVRAIMTPRNELFWIERHASREELRRTLR
NTVYTRIVVCDGGVDNPVGVILAKDMLDRLLDGRPVTIESGLRKPVVVPDTISAFDMVER
MRTVPLGIALVLDEYGSFEGIVTASDLFEAIVGEHHEPGSTPKKRMAQDDVLILDGFMPA
DEVKDRLGLSDLPDEGSYHTLGGLILALLRRVPATGDKVVFSGWLFEVLETDQRRVVKVR
ASRQALAD
Download sequence
Identical sequences A9HAA8
272568.GDI_0723 gi|162146546|ref|YP_001601005.1| WP_012223349.1.42434 WP_012223349.1.67455 gi|162146546|ref|YP_001601005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]