SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387758645|ref|YP_006065623.1| from Streptococcus pneumoniae INV200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387758645|ref|YP_006065623.1|
Domain Number 1 Region: 121-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 3.01e-49
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00018
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 4.09e-28
Family DHN aldolase/epimerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387758645|ref|YP_006065623.1|
Sequence length 270
Comment putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Streptococcus pneumoniae INV200]
Sequence
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIYILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
Download sequence
Identical sequences A0A0B7LX33 A0A158LM02 B2ISM0 C1CC82 D6ZQE7 G6J864 G6LKC4
WP_000372536.1.100012 WP_000372536.1.100110 WP_000372536.1.100114 WP_000372536.1.100140 WP_000372536.1.100164 WP_000372536.1.100168 WP_000372536.1.100169 WP_000372536.1.100240 WP_000372536.1.100263 WP_000372536.1.100339 WP_000372536.1.10035 WP_000372536.1.100397 WP_000372536.1.100525 WP_000372536.1.1006 WP_000372536.1.10060 WP_000372536.1.100629 WP_000372536.1.100679 WP_000372536.1.100805 WP_000372536.1.100816 WP_000372536.1.100829 WP_000372536.1.100839 WP_000372536.1.100855 WP_000372536.1.100863 WP_000372536.1.100874 WP_000372536.1.100914 WP_000372536.1.100937 WP_000372536.1.100947 WP_000372536.1.10103 WP_000372536.1.101061 WP_000372536.1.101080 WP_000372536.1.101135 WP_000372536.1.101167 WP_000372536.1.101176 WP_000372536.1.101178 WP_000372536.1.101205 WP_000372536.1.101219 WP_000372536.1.101241 WP_000372536.1.101250 WP_000372536.1.101256 WP_000372536.1.101274 WP_000372536.1.101286 WP_000372536.1.101315 WP_000372536.1.101438 WP_000372536.1.101484 WP_000372536.1.101560 WP_000372536.1.101599 WP_000372536.1.101614 WP_000372536.1.101689 WP_000372536.1.101729 WP_000372536.1.101765 WP_000372536.1.101789 WP_000372536.1.101847 WP_000372536.1.101857 WP_000372536.1.101895 WP_000372536.1.10196 WP_000372536.1.101988 WP_000372536.1.102091 WP_000372536.1.102129 WP_000372536.1.102134 WP_000372536.1.10221 WP_000372536.1.10261 WP_000372536.1.10284 WP_000372536.1.10314 WP_000372536.1.10364 WP_000372536.1.1050 WP_000372536.1.10571 WP_000372536.1.10574 WP_000372536.1.10591 WP_000372536.1.1068 WP_000372536.1.1070 WP_000372536.1.10708 WP_000372536.1.10731 WP_000372536.1.10747 WP_000372536.1.1076 WP_000372536.1.10766 WP_000372536.1.10820 WP_000372536.1.10914 WP_000372536.1.10933 WP_000372536.1.10934 WP_000372536.1.10951 WP_000372536.1.10952 WP_000372536.1.10987 WP_000372536.1.11 WP_000372536.1.11007 WP_000372536.1.11035 WP_000372536.1.11045 WP_000372536.1.11099 WP_000372536.1.11131 WP_000372536.1.11139 WP_000372536.1.11197 WP_000372536.1.11205 WP_000372536.1.11233 WP_000372536.1.11298 WP_000372536.1.11299 WP_000372536.1.1131 WP_000372536.1.11311 WP_000372536.1.11413 WP_000372536.1.11425 WP_000372536.1.11435 WP_000372536.1.11439 WP_000372536.1.11448 WP_000372536.1.11486 WP_000372536.1.11509 WP_000372536.1.11594 WP_000372536.1.11617 WP_000372536.1.11652 WP_000372536.1.11682 WP_000372536.1.11711 WP_000372536.1.11765 WP_000372536.1.11811 WP_000372536.1.11849 WP_000372536.1.11858 WP_000372536.1.11872 WP_000372536.1.11902 WP_000372536.1.1201 WP_000372536.1.12034 WP_000372536.1.12068 WP_000372536.1.12085 WP_000372536.1.12099 WP_000372536.1.12113 WP_000372536.1.12125 WP_000372536.1.12128 WP_000372536.1.12140 WP_000372536.1.1221 WP_000372536.1.12218 WP_000372536.1.12222 WP_000372536.1.12225 WP_000372536.1.12243 WP_000372536.1.12273 WP_000372536.1.1230 WP_000372536.1.12306 WP_000372536.1.12312 WP_000372536.1.1233 WP_000372536.1.12395 WP_000372536.1.1243 WP_000372536.1.12443 WP_000372536.1.12444 WP_000372536.1.12487 WP_000372536.1.12492 WP_000372536.1.12494 WP_000372536.1.12524 WP_000372536.1.12543 WP_000372536.1.1258 WP_000372536.1.12587 WP_000372536.1.12588 WP_000372536.1.12613 WP_000372536.1.12673 WP_000372536.1.12729 WP_000372536.1.12754 WP_000372536.1.12777 WP_000372536.1.128 WP_000372536.1.12813 WP_000372536.1.12866 WP_000372536.1.12948 WP_000372536.1.12963 WP_000372536.1.12996 WP_000372536.1.13032 WP_000372536.1.13033 WP_000372536.1.13048 WP_000372536.1.13065 WP_000372536.1.13099 WP_000372536.1.13119 WP_000372536.1.13168 WP_000372536.1.1332 WP_000372536.1.13324 WP_000372536.1.13390 WP_000372536.1.13402 WP_000372536.1.1348 WP_000372536.1.13515 WP_000372536.1.13527 WP_000372536.1.13581 WP_000372536.1.13590 WP_000372536.1.13607 WP_000372536.1.13701 WP_000372536.1.13736 WP_000372536.1.13839 WP_000372536.1.13845 WP_000372536.1.1391 WP_000372536.1.13917 WP_000372536.1.13954 WP_000372536.1.13989 WP_000372536.1.13990 WP_000372536.1.13997 WP_000372536.1.13998 WP_000372536.1.14012 WP_000372536.1.14051 WP_000372536.1.14066 WP_000372536.1.14102 WP_000372536.1.14107 WP_000372536.1.14126 WP_000372536.1.14327 WP_000372536.1.14480 WP_000372536.1.14511 WP_000372536.1.14513 WP_000372536.1.14558 WP_000372536.1.14560 WP_000372536.1.14599 WP_000372536.1.14657 WP_000372536.1.14662 WP_000372536.1.14728 WP_000372536.1.14740 WP_000372536.1.14745 WP_000372536.1.14780 WP_000372536.1.14831 WP_000372536.1.14880 WP_000372536.1.14885 WP_000372536.1.14889 WP_000372536.1.14892 WP_000372536.1.14899 WP_000372536.1.15024 WP_000372536.1.15030 WP_000372536.1.15048 WP_000372536.1.15061 WP_000372536.1.1507 WP_000372536.1.15081 WP_000372536.1.15128 WP_000372536.1.15142 WP_000372536.1.15189 WP_000372536.1.15215 WP_000372536.1.15220 WP_000372536.1.15366 WP_000372536.1.15370 WP_000372536.1.15390 WP_000372536.1.15396 WP_000372536.1.1541 WP_000372536.1.15498 WP_000372536.1.15509 WP_000372536.1.15523 WP_000372536.1.15542 WP_000372536.1.15552 WP_000372536.1.15575 WP_000372536.1.15596 WP_000372536.1.15607 WP_000372536.1.15635 WP_000372536.1.15683 WP_000372536.1.15759 WP_000372536.1.15787 WP_000372536.1.15788 WP_000372536.1.15798 WP_000372536.1.15849 WP_000372536.1.15891 WP_000372536.1.15907 WP_000372536.1.15935 WP_000372536.1.15943 WP_000372536.1.15992 WP_000372536.1.16049 WP_000372536.1.16053 WP_000372536.1.16093 WP_000372536.1.16152 WP_000372536.1.16184 WP_000372536.1.16229 WP_000372536.1.16240 WP_000372536.1.16287 WP_000372536.1.16290 WP_000372536.1.16323 WP_000372536.1.16330 WP_000372536.1.16337 WP_000372536.1.16359 WP_000372536.1.16381 WP_000372536.1.16404 WP_000372536.1.16441 WP_000372536.1.16509 WP_000372536.1.16514 WP_000372536.1.16521 WP_000372536.1.1653 WP_000372536.1.16555 WP_000372536.1.16575 WP_000372536.1.16662 WP_000372536.1.1672 WP_000372536.1.16778 WP_000372536.1.16793 WP_000372536.1.16803 WP_000372536.1.16813 WP_000372536.1.1682 WP_000372536.1.1686 WP_000372536.1.16904 WP_000372536.1.16974 WP_000372536.1.17033 WP_000372536.1.17036 WP_000372536.1.17208 WP_000372536.1.17229 WP_000372536.1.17252 WP_000372536.1.17254 WP_000372536.1.17286 WP_000372536.1.17312 WP_000372536.1.17330 WP_000372536.1.17411 WP_000372536.1.17427 WP_000372536.1.17472 WP_000372536.1.17532 WP_000372536.1.17571 WP_000372536.1.17601 WP_000372536.1.17602 WP_000372536.1.17641 WP_000372536.1.17672 WP_000372536.1.17688 WP_000372536.1.17690 WP_000372536.1.17715 WP_000372536.1.17716 WP_000372536.1.17775 WP_000372536.1.17810 WP_000372536.1.17820 WP_000372536.1.17822 WP_000372536.1.17839 WP_000372536.1.17844 WP_000372536.1.17888 WP_000372536.1.17892 WP_000372536.1.17942 WP_000372536.1.17965 WP_000372536.1.17971 WP_000372536.1.18067 WP_000372536.1.18100 WP_000372536.1.18180 WP_000372536.1.18258 WP_000372536.1.18276 WP_000372536.1.18278 WP_000372536.1.18279 WP_000372536.1.18285 WP_000372536.1.18300 WP_000372536.1.18342 WP_000372536.1.18357 WP_000372536.1.18404 WP_000372536.1.18417 WP_000372536.1.18460 WP_000372536.1.1848 WP_000372536.1.18481 WP_000372536.1.18521 WP_000372536.1.18534 WP_000372536.1.1856 WP_000372536.1.18687 WP_000372536.1.18712 WP_000372536.1.1872 WP_000372536.1.18733 WP_000372536.1.18764 WP_000372536.1.18770 WP_000372536.1.18831 WP_000372536.1.18869 WP_000372536.1.1894 WP_000372536.1.18951 WP_000372536.1.18999 WP_000372536.1.19010 WP_000372536.1.19015 WP_000372536.1.1902 WP_000372536.1.19045 WP_000372536.1.19060 WP_000372536.1.19103 WP_000372536.1.19162 WP_000372536.1.19184 WP_000372536.1.19190 WP_000372536.1.19275 WP_000372536.1.19392 WP_000372536.1.19413 WP_000372536.1.19466 WP_000372536.1.19467 WP_000372536.1.19470 WP_000372536.1.19490 WP_000372536.1.19527 WP_000372536.1.19530 WP_000372536.1.19532 WP_000372536.1.19558 WP_000372536.1.19586 WP_000372536.1.19631 WP_000372536.1.19698 WP_000372536.1.1972 WP_000372536.1.19811 WP_000372536.1.1983 WP_000372536.1.1985 WP_000372536.1.19856 WP_000372536.1.19879 WP_000372536.1.19925 WP_000372536.1.1996 WP_000372536.1.19983 WP_000372536.1.20008 WP_000372536.1.20041 WP_000372536.1.20124 WP_000372536.1.20128 WP_000372536.1.20209 WP_000372536.1.20213 WP_000372536.1.20281 WP_000372536.1.20328 WP_000372536.1.20421 WP_000372536.1.20422 WP_000372536.1.20451 WP_000372536.1.20486 WP_000372536.1.2060 WP_000372536.1.20634 WP_000372536.1.20637 WP_000372536.1.20657 WP_000372536.1.2078 WP_000372536.1.20781 WP_000372536.1.20782 WP_000372536.1.20856 WP_000372536.1.20858 WP_000372536.1.20899 WP_000372536.1.20909 WP_000372536.1.20915 WP_000372536.1.20934 WP_000372536.1.20936 WP_000372536.1.20942 WP_000372536.1.20965 WP_000372536.1.20976 WP_000372536.1.20988 WP_000372536.1.20996 WP_000372536.1.21027 WP_000372536.1.21028 WP_000372536.1.21090 WP_000372536.1.21174 WP_000372536.1.21192 WP_000372536.1.21216 WP_000372536.1.21233 WP_000372536.1.21244 WP_000372536.1.21278 WP_000372536.1.21329 WP_000372536.1.21331 WP_000372536.1.21452 WP_000372536.1.2147 WP_000372536.1.2148 WP_000372536.1.21503 WP_000372536.1.21507 WP_000372536.1.2152 WP_000372536.1.2167 WP_000372536.1.21682 WP_000372536.1.21699 WP_000372536.1.21753 WP_000372536.1.21780 WP_000372536.1.21788 WP_000372536.1.21807 WP_000372536.1.21822 WP_000372536.1.21990 WP_000372536.1.21997 WP_000372536.1.22 WP_000372536.1.22014 WP_000372536.1.2203 WP_000372536.1.22035 WP_000372536.1.22061 WP_000372536.1.22122 WP_000372536.1.22135 WP_000372536.1.22201 WP_000372536.1.22262 WP_000372536.1.22263 WP_000372536.1.22338 WP_000372536.1.22341 WP_000372536.1.22392 WP_000372536.1.22397 WP_000372536.1.22457 WP_000372536.1.22459 WP_000372536.1.22480 WP_000372536.1.22550 WP_000372536.1.22554 WP_000372536.1.22556 WP_000372536.1.22563 WP_000372536.1.2257 WP_000372536.1.2260 WP_000372536.1.2263 WP_000372536.1.22675 WP_000372536.1.22677 WP_000372536.1.22711 WP_000372536.1.22751 WP_000372536.1.22772 WP_000372536.1.22784 WP_000372536.1.2291 WP_000372536.1.22941 WP_000372536.1.22955 WP_000372536.1.22976 WP_000372536.1.23025 WP_000372536.1.23028 WP_000372536.1.23066 WP_000372536.1.23076 WP_000372536.1.23083 WP_000372536.1.23107 WP_000372536.1.23111 WP_000372536.1.23138 WP_000372536.1.23177 WP_000372536.1.23178 WP_000372536.1.2319 WP_000372536.1.23190 WP_000372536.1.23276 WP_000372536.1.23334 WP_000372536.1.23397 WP_000372536.1.23415 WP_000372536.1.23477 WP_000372536.1.23481 WP_000372536.1.23602 WP_000372536.1.2361 WP_000372536.1.23656 WP_000372536.1.23722 WP_000372536.1.23853 WP_000372536.1.23929 WP_000372536.1.23968 WP_000372536.1.23978 WP_000372536.1.23991 WP_000372536.1.24010 WP_000372536.1.24043 WP_000372536.1.24067 WP_000372536.1.24094 WP_000372536.1.24203 WP_000372536.1.24218 WP_000372536.1.24220 WP_000372536.1.24262 WP_000372536.1.243 WP_000372536.1.2431 WP_000372536.1.24312 WP_000372536.1.24318 WP_000372536.1.24324 WP_000372536.1.24395 WP_000372536.1.2444 WP_000372536.1.24471 WP_000372536.1.24540 WP_000372536.1.24562 WP_000372536.1.24571 WP_000372536.1.24573 WP_000372536.1.24598 WP_000372536.1.2461 WP_000372536.1.24610 WP_000372536.1.24620 WP_000372536.1.2465 WP_000372536.1.24653 WP_000372536.1.24658 WP_000372536.1.24772 WP_000372536.1.24788 WP_000372536.1.24835 WP_000372536.1.249 WP_000372536.1.24928 WP_000372536.1.24989 WP_000372536.1.24993 WP_000372536.1.25005 WP_000372536.1.2503 WP_000372536.1.25106 WP_000372536.1.25121 WP_000372536.1.25124 WP_000372536.1.25132 WP_000372536.1.25139 WP_000372536.1.25155 WP_000372536.1.252 WP_000372536.1.25222 WP_000372536.1.25226 WP_000372536.1.25228 WP_000372536.1.25293 WP_000372536.1.2533 WP_000372536.1.25439 WP_000372536.1.25461 WP_000372536.1.25494 WP_000372536.1.25502 WP_000372536.1.2553 WP_000372536.1.25543 WP_000372536.1.2556 WP_000372536.1.25571 WP_000372536.1.25581 WP_000372536.1.25589 WP_000372536.1.25686 WP_000372536.1.25707 WP_000372536.1.25714 WP_000372536.1.2573 WP_000372536.1.25742 WP_000372536.1.25768 WP_000372536.1.25818 WP_000372536.1.2586 WP_000372536.1.25888 WP_000372536.1.25934 WP_000372536.1.25958 WP_000372536.1.26041 WP_000372536.1.26059 WP_000372536.1.2607 WP_000372536.1.26078 WP_000372536.1.26220 WP_000372536.1.26279 WP_000372536.1.26344 WP_000372536.1.26369 WP_000372536.1.26371 WP_000372536.1.26392 WP_000372536.1.26490 WP_000372536.1.26496 WP_000372536.1.26653 WP_000372536.1.26781 WP_000372536.1.26785 WP_000372536.1.26799 WP_000372536.1.26823 WP_000372536.1.26855 WP_000372536.1.26858 WP_000372536.1.26900 WP_000372536.1.26901 WP_000372536.1.26925 WP_000372536.1.26953 WP_000372536.1.26990 WP_000372536.1.2703 WP_000372536.1.27046 WP_000372536.1.27071 WP_000372536.1.27076 WP_000372536.1.27119 WP_000372536.1.2721 WP_000372536.1.27219 WP_000372536.1.27249 WP_000372536.1.27252 WP_000372536.1.27267 WP_000372536.1.27289 WP_000372536.1.2729 WP_000372536.1.27312 WP_000372536.1.27421 WP_000372536.1.27432 WP_000372536.1.2750 WP_000372536.1.27581 WP_000372536.1.276 WP_000372536.1.27601 WP_000372536.1.27636 WP_000372536.1.27714 WP_000372536.1.27740 WP_000372536.1.27759 WP_000372536.1.27789 WP_000372536.1.27808 WP_000372536.1.27853 WP_000372536.1.2786 WP_000372536.1.27862 WP_000372536.1.27886 WP_000372536.1.27887 WP_000372536.1.27904 WP_000372536.1.27907 WP_000372536.1.27912 WP_000372536.1.27917 WP_000372536.1.27970 WP_000372536.1.28014 WP_000372536.1.28028 WP_000372536.1.28058 WP_000372536.1.28089 WP_000372536.1.28121 WP_000372536.1.28140 WP_000372536.1.28151 WP_000372536.1.28180 WP_000372536.1.28183 WP_000372536.1.28296 WP_000372536.1.2830 WP_000372536.1.28326 WP_000372536.1.28350 WP_000372536.1.28351 WP_000372536.1.28379 WP_000372536.1.28450 WP_000372536.1.28457 WP_000372536.1.28519 WP_000372536.1.28537 WP_000372536.1.28548 WP_000372536.1.28572 WP_000372536.1.2861 WP_000372536.1.28659 WP_000372536.1.28761 WP_000372536.1.28771 WP_000372536.1.28794 WP_000372536.1.28812 WP_000372536.1.28816 WP_000372536.1.28834 WP_000372536.1.28846 WP_000372536.1.28867 WP_000372536.1.28868 WP_000372536.1.28869 WP_000372536.1.28892 WP_000372536.1.28945 WP_000372536.1.28997 WP_000372536.1.29009 WP_000372536.1.29018 WP_000372536.1.2909 WP_000372536.1.29175 WP_000372536.1.29181 WP_000372536.1.29232 WP_000372536.1.29289 WP_000372536.1.29307 WP_000372536.1.29321 WP_000372536.1.29323 WP_000372536.1.29360 WP_000372536.1.2940 WP_000372536.1.29406 WP_000372536.1.29442 WP_000372536.1.2951 WP_000372536.1.29536 WP_000372536.1.29624 WP_000372536.1.29653 WP_000372536.1.2966 WP_000372536.1.2970 WP_000372536.1.29702 WP_000372536.1.29734 WP_000372536.1.29751 WP_000372536.1.29783 WP_000372536.1.29852 WP_000372536.1.29868 WP_000372536.1.29881 WP_000372536.1.29894 WP_000372536.1.29921 WP_000372536.1.30011 WP_000372536.1.30066 WP_000372536.1.30102 WP_000372536.1.3011 WP_000372536.1.30133 WP_000372536.1.30134 WP_000372536.1.30135 WP_000372536.1.30219 WP_000372536.1.30229 WP_000372536.1.30245 WP_000372536.1.30255 WP_000372536.1.30290 WP_000372536.1.30301 WP_000372536.1.30326 WP_000372536.1.30342 WP_000372536.1.3040 WP_000372536.1.30405 WP_000372536.1.30446 WP_000372536.1.30480 WP_000372536.1.30514 WP_000372536.1.30538 WP_000372536.1.30543 WP_000372536.1.30545 WP_000372536.1.30549 WP_000372536.1.30591 WP_000372536.1.30607 WP_000372536.1.30612 WP_000372536.1.30676 WP_000372536.1.30712 WP_000372536.1.30755 WP_000372536.1.3085 WP_000372536.1.30865 WP_000372536.1.30933 WP_000372536.1.30948 WP_000372536.1.30956 WP_000372536.1.30964 WP_000372536.1.31004 WP_000372536.1.31031 WP_000372536.1.31082 WP_000372536.1.31099 WP_000372536.1.31134 WP_000372536.1.31191 WP_000372536.1.31275 WP_000372536.1.31333 WP_000372536.1.31427 WP_000372536.1.31439 WP_000372536.1.31443 WP_000372536.1.31466 WP_000372536.1.31473 WP_000372536.1.31488 WP_000372536.1.3152 WP_000372536.1.31522 WP_000372536.1.31550 WP_000372536.1.31553 WP_000372536.1.3156 WP_000372536.1.31566 WP_000372536.1.31574 WP_000372536.1.31619 WP_000372536.1.31695 WP_000372536.1.31757 WP_000372536.1.31889 WP_000372536.1.31935 WP_000372536.1.31975 WP_000372536.1.320 WP_000372536.1.32032 WP_000372536.1.32058 WP_000372536.1.32068 WP_000372536.1.32079 WP_000372536.1.32080 WP_000372536.1.32117 WP_000372536.1.32139 WP_000372536.1.32187 WP_000372536.1.32280 WP_000372536.1.32282 WP_000372536.1.32290 WP_000372536.1.32303 WP_000372536.1.32334 WP_000372536.1.32362 WP_000372536.1.32413 WP_000372536.1.32419 WP_000372536.1.32606 WP_000372536.1.32642 WP_000372536.1.32696 WP_000372536.1.32701 WP_000372536.1.32717 WP_000372536.1.32719 WP_000372536.1.32735 WP_000372536.1.32768 WP_000372536.1.32774 WP_000372536.1.32782 WP_000372536.1.32816 WP_000372536.1.32820 WP_000372536.1.3287 WP_000372536.1.32892 WP_000372536.1.32949 WP_000372536.1.32968 WP_000372536.1.32994 WP_000372536.1.33020 WP_000372536.1.33021 WP_000372536.1.33070 WP_000372536.1.33071 WP_000372536.1.33113 WP_000372536.1.33188 WP_000372536.1.33291 WP_000372536.1.33359 WP_000372536.1.33361 WP_000372536.1.33378 WP_000372536.1.33391 WP_000372536.1.33430 WP_000372536.1.33454 WP_000372536.1.33637 WP_000372536.1.33647 WP_000372536.1.33666 WP_000372536.1.3375 WP_000372536.1.33758 WP_000372536.1.33781 WP_000372536.1.33802 WP_000372536.1.33807 WP_000372536.1.33874 WP_000372536.1.33881 WP_000372536.1.33923 WP_000372536.1.33950 WP_000372536.1.33956 WP_000372536.1.33960 WP_000372536.1.34015 WP_000372536.1.34120 WP_000372536.1.34176 WP_000372536.1.34291 WP_000372536.1.34309 WP_000372536.1.3433 WP_000372536.1.34466 WP_000372536.1.34485 WP_000372536.1.34503 WP_000372536.1.34506 WP_000372536.1.34508 WP_000372536.1.34559 WP_000372536.1.34598 WP_000372536.1.34601 WP_000372536.1.34616 WP_000372536.1.34699 WP_000372536.1.34739 WP_000372536.1.34742 WP_000372536.1.34744 WP_000372536.1.34776 WP_000372536.1.34809 WP_000372536.1.34839 WP_000372536.1.34848 WP_000372536.1.3487 WP_000372536.1.3488 WP_000372536.1.34886 WP_000372536.1.3496 WP_000372536.1.35042 WP_000372536.1.3505 WP_000372536.1.35064 WP_000372536.1.35098 WP_000372536.1.35117 WP_000372536.1.35124 WP_000372536.1.35217 WP_000372536.1.35232 WP_000372536.1.35247 WP_000372536.1.35248 WP_000372536.1.35305 WP_000372536.1.35358 WP_000372536.1.35380 WP_000372536.1.35383 WP_000372536.1.35392 WP_000372536.1.35411 WP_000372536.1.35432 WP_000372536.1.35458 WP_000372536.1.35459 WP_000372536.1.35528 WP_000372536.1.35597 WP_000372536.1.35634 WP_000372536.1.35640 WP_000372536.1.35655 WP_000372536.1.35678 WP_000372536.1.35708 WP_000372536.1.3571 WP_000372536.1.35727 WP_000372536.1.35763 WP_000372536.1.35776 WP_000372536.1.35836 WP_000372536.1.35905 WP_000372536.1.35919 WP_000372536.1.35943 WP_000372536.1.35960 WP_000372536.1.35972 WP_000372536.1.36054 WP_000372536.1.36131 WP_000372536.1.3618 WP_000372536.1.3619 WP_000372536.1.3621 WP_000372536.1.36234 WP_000372536.1.3638 WP_000372536.1.36404 WP_000372536.1.36463 WP_000372536.1.36493 WP_000372536.1.36510 WP_000372536.1.36552 WP_000372536.1.36554 WP_000372536.1.36568 WP_000372536.1.36762 WP_000372536.1.36780 WP_000372536.1.36923 WP_000372536.1.36943 WP_000372536.1.36961 WP_000372536.1.36965 WP_000372536.1.37022 WP_000372536.1.37033 WP_000372536.1.37136 WP_000372536.1.37164 WP_000372536.1.37205 WP_000372536.1.37227 WP_000372536.1.37246 WP_000372536.1.37268 WP_000372536.1.3727 WP_000372536.1.37289 WP_000372536.1.37300 WP_000372536.1.37340 WP_000372536.1.37390 WP_000372536.1.37443 WP_000372536.1.37458 WP_000372536.1.37629 WP_000372536.1.3763 WP_000372536.1.37696 WP_000372536.1.37713 WP_000372536.1.37728 WP_000372536.1.3780 WP_000372536.1.37840 WP_000372536.1.37876 WP_000372536.1.38024 WP_000372536.1.38056 WP_000372536.1.38184 WP_000372536.1.38288 WP_000372536.1.38374 WP_000372536.1.38429 WP_000372536.1.3844 WP_000372536.1.38503 WP_000372536.1.38506 WP_000372536.1.38519 WP_000372536.1.38605 WP_000372536.1.38665 WP_000372536.1.38676 WP_000372536.1.38695 WP_000372536.1.38697 WP_000372536.1.38718 WP_000372536.1.38738 WP_000372536.1.3876 WP_000372536.1.38770 WP_000372536.1.38778 WP_000372536.1.38783 WP_000372536.1.38861 WP_000372536.1.38887 WP_000372536.1.38892 WP_000372536.1.38957 WP_000372536.1.38969 WP_000372536.1.39033 WP_000372536.1.39079 WP_000372536.1.39087 WP_000372536.1.39093 WP_000372536.1.39098 WP_000372536.1.39133 WP_000372536.1.3917 WP_000372536.1.39175 WP_000372536.1.39198 WP_000372536.1.392 WP_000372536.1.39219 WP_000372536.1.39227 WP_000372536.1.3928 WP_000372536.1.39292 WP_000372536.1.39304 WP_000372536.1.3932 WP_000372536.1.39321 WP_000372536.1.39322 WP_000372536.1.39336 WP_000372536.1.3934 WP_000372536.1.39343 WP_000372536.1.39357 WP_000372536.1.39394 WP_000372536.1.39453 WP_000372536.1.39479 WP_000372536.1.3948 WP_000372536.1.39505 WP_000372536.1.39591 WP_000372536.1.3966 WP_000372536.1.39663 WP_000372536.1.39719 WP_000372536.1.39731 WP_000372536.1.39736 WP_000372536.1.39754 WP_000372536.1.39813 WP_000372536.1.39866 WP_000372536.1.39872 WP_000372536.1.39931 WP_000372536.1.39944 WP_000372536.1.39990 WP_000372536.1.400 WP_000372536.1.40005 WP_000372536.1.40007 WP_000372536.1.40027 WP_000372536.1.40092 WP_000372536.1.40106 WP_000372536.1.40112 WP_000372536.1.40216 WP_000372536.1.4023 WP_000372536.1.40269 WP_000372536.1.40296 WP_000372536.1.40303 WP_000372536.1.40306 WP_000372536.1.40362 WP_000372536.1.40363 WP_000372536.1.40457 WP_000372536.1.40475 WP_000372536.1.40568 WP_000372536.1.40574 WP_000372536.1.40626 WP_000372536.1.40728 WP_000372536.1.40737 WP_000372536.1.40738 WP_000372536.1.40746 WP_000372536.1.40801 WP_000372536.1.40850 WP_000372536.1.40931 WP_000372536.1.40960 WP_000372536.1.40982 WP_000372536.1.40985 WP_000372536.1.40986 WP_000372536.1.41008 WP_000372536.1.41021 WP_000372536.1.41025 WP_000372536.1.41047 WP_000372536.1.41088 WP_000372536.1.4111 WP_000372536.1.41138 WP_000372536.1.41186 WP_000372536.1.41203 WP_000372536.1.41209 WP_000372536.1.41275 WP_000372536.1.41317 WP_000372536.1.41387 WP_000372536.1.4143 WP_000372536.1.41450 WP_000372536.1.41467 WP_000372536.1.41476 WP_000372536.1.41551 WP_000372536.1.41652 WP_000372536.1.41673 WP_000372536.1.41775 WP_000372536.1.41808 WP_000372536.1.41850 WP_000372536.1.41914 WP_000372536.1.41932 WP_000372536.1.41952 WP_000372536.1.4201 WP_000372536.1.42021 WP_000372536.1.42024 WP_000372536.1.42076 WP_000372536.1.42121 WP_000372536.1.42173 WP_000372536.1.42195 WP_000372536.1.42199 WP_000372536.1.42204 WP_000372536.1.42275 WP_000372536.1.4230 WP_000372536.1.42303 WP_000372536.1.42348 WP_000372536.1.42450 WP_000372536.1.42515 WP_000372536.1.42566 WP_000372536.1.42611 WP_000372536.1.42642 WP_000372536.1.42760 WP_000372536.1.42792 WP_000372536.1.42807 WP_000372536.1.42817 WP_000372536.1.42820 WP_000372536.1.42825 WP_000372536.1.4283 WP_000372536.1.42846 WP_000372536.1.42873 WP_000372536.1.42906 WP_000372536.1.42933 WP_000372536.1.42938 WP_000372536.1.43012 WP_000372536.1.43029 WP_000372536.1.43045 WP_000372536.1.43051 WP_000372536.1.43059 WP_000372536.1.43074 WP_000372536.1.43119 WP_000372536.1.43150 WP_000372536.1.4320 WP_000372536.1.43205 WP_000372536.1.43219 WP_000372536.1.4328 WP_000372536.1.43294 WP_000372536.1.43300 WP_000372536.1.43343 WP_000372536.1.43344 WP_000372536.1.43345 WP_000372536.1.43347 WP_000372536.1.43361 WP_000372536.1.43367 WP_000372536.1.43424 WP_000372536.1.43527 WP_000372536.1.43558 WP_000372536.1.43584 WP_000372536.1.43658 WP_000372536.1.43698 WP_000372536.1.43723 WP_000372536.1.43739 WP_000372536.1.43741 WP_000372536.1.43753 WP_000372536.1.43771 WP_000372536.1.43774 WP_000372536.1.43792 WP_000372536.1.43848 WP_000372536.1.43870 WP_000372536.1.43887 WP_000372536.1.43889 WP_000372536.1.43932 WP_000372536.1.43934 WP_000372536.1.43972 WP_000372536.1.43979 WP_000372536.1.44022 WP_000372536.1.44131 WP_000372536.1.44135 WP_000372536.1.44145 WP_000372536.1.44209 WP_000372536.1.4425 WP_000372536.1.44306 WP_000372536.1.4432 WP_000372536.1.44387 WP_000372536.1.44403 WP_000372536.1.4442 WP_000372536.1.44421 WP_000372536.1.44487 WP_000372536.1.44512 WP_000372536.1.44533 WP_000372536.1.44550 WP_000372536.1.4456 WP_000372536.1.44574 WP_000372536.1.44584 WP_000372536.1.44595 WP_000372536.1.44601 WP_000372536.1.44644 WP_000372536.1.44647 WP_000372536.1.44682 WP_000372536.1.44699 WP_000372536.1.44764 WP_000372536.1.44825 WP_000372536.1.44835 WP_000372536.1.44850 WP_000372536.1.4491 WP_000372536.1.44921 WP_000372536.1.44937 WP_000372536.1.44938 WP_000372536.1.44972 WP_000372536.1.44987 WP_000372536.1.44995 WP_000372536.1.45078 WP_000372536.1.45120 WP_000372536.1.45166 WP_000372536.1.45224 WP_000372536.1.4525 WP_000372536.1.45263 WP_000372536.1.45346 WP_000372536.1.45357 WP_000372536.1.4536 WP_000372536.1.45433 WP_000372536.1.45528 WP_000372536.1.45606 WP_000372536.1.45639 WP_000372536.1.45687 WP_000372536.1.45688 WP_000372536.1.45691 WP_000372536.1.45825 WP_000372536.1.45879 WP_000372536.1.45905 WP_000372536.1.45948 WP_000372536.1.45993 WP_000372536.1.45997 WP_000372536.1.46074 WP_000372536.1.46094 WP_000372536.1.46149 WP_000372536.1.46206 WP_000372536.1.46281 WP_000372536.1.46284 WP_000372536.1.46295 WP_000372536.1.46309 WP_000372536.1.46315 WP_000372536.1.46470 WP_000372536.1.46500 WP_000372536.1.46501 WP_000372536.1.46571 WP_000372536.1.46607 WP_000372536.1.4663 WP_000372536.1.46634 WP_000372536.1.46665 WP_000372536.1.46683 WP_000372536.1.46694 WP_000372536.1.46716 WP_000372536.1.46809 WP_000372536.1.46893 WP_000372536.1.469 WP_000372536.1.46915 WP_000372536.1.46966 WP_000372536.1.47045 WP_000372536.1.47091 WP_000372536.1.47133 WP_000372536.1.47272 WP_000372536.1.47327 WP_000372536.1.47338 WP_000372536.1.47351 WP_000372536.1.47409 WP_000372536.1.47415 WP_000372536.1.47712 WP_000372536.1.47806 WP_000372536.1.47853 WP_000372536.1.4789 WP_000372536.1.4804 WP_000372536.1.48060 WP_000372536.1.48112 WP_000372536.1.48118 WP_000372536.1.4817 WP_000372536.1.48181 WP_000372536.1.4822 WP_000372536.1.48257 WP_000372536.1.48339 WP_000372536.1.48395 WP_000372536.1.48481 WP_000372536.1.48498 WP_000372536.1.48589 WP_000372536.1.48594 WP_000372536.1.48595 WP_000372536.1.48613 WP_000372536.1.48625 WP_000372536.1.48713 WP_000372536.1.48718 WP_000372536.1.48739 WP_000372536.1.48758 WP_000372536.1.48762 WP_000372536.1.48767 WP_000372536.1.48799 WP_000372536.1.48804 WP_000372536.1.48828 WP_000372536.1.48867 WP_000372536.1.4894 WP_000372536.1.48998 WP_000372536.1.490 WP_000372536.1.49021 WP_000372536.1.49038 WP_000372536.1.49050 WP_000372536.1.49062 WP_000372536.1.49115 WP_000372536.1.49118 WP_000372536.1.49122 WP_000372536.1.49213 WP_000372536.1.49232 WP_000372536.1.4936 WP_000372536.1.49511 WP_000372536.1.49514 WP_000372536.1.49601 WP_000372536.1.49656 WP_000372536.1.49692 WP_000372536.1.49873 WP_000372536.1.49889 WP_000372536.1.49904 WP_000372536.1.49955 WP_000372536.1.49964 WP_000372536.1.49973 WP_000372536.1.5000 WP_000372536.1.50048 WP_000372536.1.50059 WP_000372536.1.50070 WP_000372536.1.50105 WP_000372536.1.50139 WP_000372536.1.50143 WP_000372536.1.50151 WP_000372536.1.50168 WP_000372536.1.502 WP_000372536.1.50209 WP_000372536.1.5022 WP_000372536.1.50244 WP_000372536.1.50259 WP_000372536.1.50275 WP_000372536.1.50305 WP_000372536.1.50315 WP_000372536.1.50396 WP_000372536.1.50422 WP_000372536.1.50442 WP_000372536.1.50454 WP_000372536.1.50474 WP_000372536.1.50501 WP_000372536.1.50580 WP_000372536.1.50582 WP_000372536.1.50606 WP_000372536.1.50615 WP_000372536.1.50637 WP_000372536.1.50685 WP_000372536.1.50743 WP_000372536.1.50757 WP_000372536.1.50785 WP_000372536.1.50821 WP_000372536.1.50836 WP_000372536.1.50846 WP_000372536.1.50849 WP_000372536.1.50911 WP_000372536.1.50985 WP_000372536.1.51032 WP_000372536.1.51054 WP_000372536.1.51075 WP_000372536.1.51079 WP_000372536.1.51083 WP_000372536.1.51098 WP_000372536.1.51143 WP_000372536.1.51145 WP_000372536.1.51188 WP_000372536.1.5122 WP_000372536.1.51237 WP_000372536.1.51238 WP_000372536.1.51243 WP_000372536.1.51316 WP_000372536.1.51367 WP_000372536.1.51379 WP_000372536.1.51420 WP_000372536.1.51439 WP_000372536.1.51475 WP_000372536.1.51507 WP_000372536.1.51554 WP_000372536.1.51579 WP_000372536.1.5166 WP_000372536.1.51673 WP_000372536.1.51674 WP_000372536.1.51742 WP_000372536.1.51776 WP_000372536.1.51806 WP_000372536.1.51820 WP_000372536.1.51835 WP_000372536.1.51893 WP_000372536.1.51908 WP_000372536.1.51960 WP_000372536.1.51983 WP_000372536.1.5204 WP_000372536.1.52060 WP_000372536.1.52064 WP_000372536.1.5207 WP_000372536.1.52231 WP_000372536.1.52245 WP_000372536.1.52315 WP_000372536.1.52329 WP_000372536.1.52384 WP_000372536.1.52412 WP_000372536.1.52515 WP_000372536.1.52540 WP_000372536.1.52551 WP_000372536.1.52581 WP_000372536.1.52721 WP_000372536.1.52759 WP_000372536.1.52786 WP_000372536.1.52842 WP_000372536.1.52843 WP_000372536.1.52923 WP_000372536.1.52978 WP_000372536.1.52987 WP_000372536.1.52994 WP_000372536.1.53040 WP_000372536.1.53054 WP_000372536.1.53068 WP_000372536.1.53108 WP_000372536.1.53112 WP_000372536.1.53135 WP_000372536.1.53183 WP_000372536.1.53205 WP_000372536.1.53212 WP_000372536.1.53241 WP_000372536.1.53243 WP_000372536.1.53268 WP_000372536.1.53291 WP_000372536.1.53297 WP_000372536.1.53320 WP_000372536.1.53337 WP_000372536.1.53357 WP_000372536.1.53365 WP_000372536.1.53395 WP_000372536.1.53429 WP_000372536.1.53430 WP_000372536.1.5348 WP_000372536.1.53524 WP_000372536.1.53547 WP_000372536.1.53619 WP_000372536.1.53622 WP_000372536.1.53652 WP_000372536.1.53684 WP_000372536.1.53697 WP_000372536.1.53756 WP_000372536.1.53789 WP_000372536.1.53798 WP_000372536.1.54020 WP_000372536.1.54021 WP_000372536.1.5405 WP_000372536.1.54050 WP_000372536.1.54064 WP_000372536.1.54066 WP_000372536.1.54069 WP_000372536.1.54110 WP_000372536.1.5418 WP_000372536.1.543 WP_000372536.1.5432 WP_000372536.1.5435 WP_000372536.1.54401 WP_000372536.1.54402 WP_000372536.1.54424 WP_000372536.1.54457 WP_000372536.1.54549 WP_000372536.1.54658 WP_000372536.1.54680 WP_000372536.1.54738 WP_000372536.1.54762 WP_000372536.1.54792 WP_000372536.1.54796 WP_000372536.1.54810 WP_000372536.1.54813 WP_000372536.1.54840 WP_000372536.1.54862 WP_000372536.1.54932 WP_000372536.1.54938 WP_000372536.1.5495 WP_000372536.1.54960 WP_000372536.1.55035 WP_000372536.1.55039 WP_000372536.1.55053 WP_000372536.1.55071 WP_000372536.1.55079 WP_000372536.1.55091 WP_000372536.1.55107 WP_000372536.1.55217 WP_000372536.1.55262 WP_000372536.1.5528 WP_000372536.1.55292 WP_000372536.1.55298 WP_000372536.1.55299 WP_000372536.1.55314 WP_000372536.1.55329 WP_000372536.1.5537 WP_000372536.1.55377 WP_000372536.1.55388 WP_000372536.1.55409 WP_000372536.1.55426 WP_000372536.1.55432 WP_000372536.1.55502 WP_000372536.1.55531 WP_000372536.1.55532 WP_000372536.1.55534 WP_000372536.1.55589 WP_000372536.1.55677 WP_000372536.1.55716 WP_000372536.1.55722 WP_000372536.1.55726 WP_000372536.1.55736 WP_000372536.1.55823 WP_000372536.1.55836 WP_000372536.1.55881 WP_000372536.1.55903 WP_000372536.1.55906 WP_000372536.1.55980 WP_000372536.1.5599 WP_000372536.1.560 WP_000372536.1.56041 WP_000372536.1.56062 WP_000372536.1.56136 WP_000372536.1.56185 WP_000372536.1.56251 WP_000372536.1.56276 WP_000372536.1.56408 WP_000372536.1.56462 WP_000372536.1.56518 WP_000372536.1.56568 WP_000372536.1.56581 WP_000372536.1.56622 WP_000372536.1.5663 WP_000372536.1.56657 WP_000372536.1.56749 WP_000372536.1.56756 WP_000372536.1.5689 WP_000372536.1.56989 WP_000372536.1.57009 WP_000372536.1.57017 WP_000372536.1.57119 WP_000372536.1.57219 WP_000372536.1.57279 WP_000372536.1.57366 WP_000372536.1.57394 WP_000372536.1.5741 WP_000372536.1.57428 WP_000372536.1.57442 WP_000372536.1.57472 WP_000372536.1.57503 WP_000372536.1.57508 WP_000372536.1.57530 WP_000372536.1.57615 WP_000372536.1.57677 WP_000372536.1.57725 WP_000372536.1.57726 WP_000372536.1.57750 WP_000372536.1.57753 WP_000372536.1.57760 WP_000372536.1.5779 WP_000372536.1.57816 WP_000372536.1.57876 WP_000372536.1.58020 WP_000372536.1.58036 WP_000372536.1.58076 WP_000372536.1.58166 WP_000372536.1.5819 WP_000372536.1.58197 WP_000372536.1.58211 WP_000372536.1.58227 WP_000372536.1.58331 WP_000372536.1.58342 WP_000372536.1.58348 WP_000372536.1.58361 WP_000372536.1.58458 WP_000372536.1.58483 WP_000372536.1.58492 WP_000372536.1.58522 WP_000372536.1.58553 WP_000372536.1.58574 WP_000372536.1.58595 WP_000372536.1.58607 WP_000372536.1.58645 WP_000372536.1.58646 WP_000372536.1.58670 WP_000372536.1.58679 WP_000372536.1.58684 WP_000372536.1.58738 WP_000372536.1.58761 WP_000372536.1.58843 WP_000372536.1.58905 WP_000372536.1.5892 WP_000372536.1.58948 WP_000372536.1.59001 WP_000372536.1.59007 WP_000372536.1.59018 WP_000372536.1.59033 WP_000372536.1.59065 WP_000372536.1.5916 WP_000372536.1.59160 WP_000372536.1.5921 WP_000372536.1.59215 WP_000372536.1.59229 WP_000372536.1.59235 WP_000372536.1.59257 WP_000372536.1.59268 WP_000372536.1.5934 WP_000372536.1.59367 WP_000372536.1.59424 WP_000372536.1.59437 WP_000372536.1.59442 WP_000372536.1.59534 WP_000372536.1.59606 WP_000372536.1.59608 WP_000372536.1.59700 WP_000372536.1.59721 WP_000372536.1.59785 WP_000372536.1.59867 WP_000372536.1.59884 WP_000372536.1.59895 WP_000372536.1.59913 WP_000372536.1.59918 WP_000372536.1.59938 WP_000372536.1.60073 WP_000372536.1.60083 WP_000372536.1.60148 WP_000372536.1.60174 WP_000372536.1.60177 WP_000372536.1.60180 WP_000372536.1.60210 WP_000372536.1.60242 WP_000372536.1.60256 WP_000372536.1.60303 WP_000372536.1.60309 WP_000372536.1.60384 WP_000372536.1.60385 WP_000372536.1.60391 WP_000372536.1.60438 WP_000372536.1.60450 WP_000372536.1.6046 WP_000372536.1.60485 WP_000372536.1.60532 WP_000372536.1.60574 WP_000372536.1.60592 WP_000372536.1.60621 WP_000372536.1.60642 WP_000372536.1.60645 WP_000372536.1.60646 WP_000372536.1.60656 WP_000372536.1.60670 WP_000372536.1.60714 WP_000372536.1.60723 WP_000372536.1.60731 WP_000372536.1.60737 WP_000372536.1.60749 WP_000372536.1.60755 WP_000372536.1.6081 WP_000372536.1.60812 WP_000372536.1.60867 WP_000372536.1.6087 WP_000372536.1.60886 WP_000372536.1.60911 WP_000372536.1.61007 WP_000372536.1.61043 WP_000372536.1.61088 WP_000372536.1.61155 WP_000372536.1.61159 WP_000372536.1.61160 WP_000372536.1.61164 WP_000372536.1.61182 WP_000372536.1.61226 WP_000372536.1.61250 WP_000372536.1.61301 WP_000372536.1.6140 WP_000372536.1.61451 WP_000372536.1.61489 WP_000372536.1.61514 WP_000372536.1.61541 WP_000372536.1.61548 WP_000372536.1.61550 WP_000372536.1.61568 WP_000372536.1.61605 WP_000372536.1.61627 WP_000372536.1.61675 WP_000372536.1.61686 WP_000372536.1.61700 WP_000372536.1.61733 WP_000372536.1.61765 WP_000372536.1.61837 WP_000372536.1.61912 WP_000372536.1.61916 WP_000372536.1.61992 WP_000372536.1.62001 WP_000372536.1.62022 WP_000372536.1.62039 WP_000372536.1.62118 WP_000372536.1.62145 WP_000372536.1.62178 WP_000372536.1.62216 WP_000372536.1.62283 WP_000372536.1.62293 WP_000372536.1.62315 WP_000372536.1.62366 WP_000372536.1.62394 WP_000372536.1.62417 WP_000372536.1.62421 WP_000372536.1.6244 WP_000372536.1.62524 WP_000372536.1.62532 WP_000372536.1.62540 WP_000372536.1.62583 WP_000372536.1.62779 WP_000372536.1.62793 WP_000372536.1.62814 WP_000372536.1.62821 WP_000372536.1.62836 WP_000372536.1.62867 WP_000372536.1.62889 WP_000372536.1.62994 WP_000372536.1.63029 WP_000372536.1.6306 WP_000372536.1.63077 WP_000372536.1.63128 WP_000372536.1.63149 WP_000372536.1.63165 WP_000372536.1.63214 WP_000372536.1.63238 WP_000372536.1.6324 WP_000372536.1.63431 WP_000372536.1.63503 WP_000372536.1.63506 WP_000372536.1.63544 WP_000372536.1.63741 WP_000372536.1.63756 WP_000372536.1.63788 WP_000372536.1.6382 WP_000372536.1.63882 WP_000372536.1.63891 WP_000372536.1.63893 WP_000372536.1.63919 WP_000372536.1.63920 WP_000372536.1.63927 WP_000372536.1.63931 WP_000372536.1.63935 WP_000372536.1.63938 WP_000372536.1.63988 WP_000372536.1.64002 WP_000372536.1.64006 WP_000372536.1.64055 WP_000372536.1.64126 WP_000372536.1.64163 WP_000372536.1.64184 WP_000372536.1.64203 WP_000372536.1.64246 WP_000372536.1.64255 WP_000372536.1.64262 WP_000372536.1.64269 WP_000372536.1.64316 WP_000372536.1.64416 WP_000372536.1.64464 WP_000372536.1.64496 WP_000372536.1.64572 WP_000372536.1.64576 WP_000372536.1.64653 WP_000372536.1.6467 WP_000372536.1.64679 WP_000372536.1.64696 WP_000372536.1.64728 WP_000372536.1.64734 WP_000372536.1.6474 WP_000372536.1.64778 WP_000372536.1.64851 WP_000372536.1.64876 WP_000372536.1.64906 WP_000372536.1.64923 WP_000372536.1.6498 WP_000372536.1.6504 WP_000372536.1.65062 WP_000372536.1.65087 WP_000372536.1.65107 WP_000372536.1.65396 WP_000372536.1.65418 WP_000372536.1.65442 WP_000372536.1.65476 WP_000372536.1.65485 WP_000372536.1.65492 WP_000372536.1.65542 WP_000372536.1.65577 WP_000372536.1.65587 WP_000372536.1.65641 WP_000372536.1.65690 WP_000372536.1.65722 WP_000372536.1.65742 WP_000372536.1.65773 WP_000372536.1.65789 WP_000372536.1.6580 WP_000372536.1.65806 WP_000372536.1.65814 WP_000372536.1.65829 WP_000372536.1.65896 WP_000372536.1.66087 WP_000372536.1.66139 WP_000372536.1.66146 WP_000372536.1.66166 WP_000372536.1.6621 WP_000372536.1.66230 WP_000372536.1.6625 WP_000372536.1.66278 WP_000372536.1.66309 WP_000372536.1.66381 WP_000372536.1.66411 WP_000372536.1.66490 WP_000372536.1.66500 WP_000372536.1.66517 WP_000372536.1.66586 WP_000372536.1.66595 WP_000372536.1.66653 WP_000372536.1.6679 WP_000372536.1.66797 WP_000372536.1.66813 WP_000372536.1.66835 WP_000372536.1.66881 WP_000372536.1.66894 WP_000372536.1.669 WP_000372536.1.66971 WP_000372536.1.66973 WP_000372536.1.66995 WP_000372536.1.67084 WP_000372536.1.67114 WP_000372536.1.67169 WP_000372536.1.67206 WP_000372536.1.67215 WP_000372536.1.673 WP_000372536.1.67304 WP_000372536.1.67358 WP_000372536.1.67398 WP_000372536.1.67401 WP_000372536.1.67416 WP_000372536.1.67458 WP_000372536.1.67494 WP_000372536.1.67557 WP_000372536.1.67565 WP_000372536.1.67583 WP_000372536.1.67596 WP_000372536.1.67739 WP_000372536.1.67741 WP_000372536.1.67797 WP_000372536.1.67804 WP_000372536.1.67807 WP_000372536.1.67965 WP_000372536.1.68017 WP_000372536.1.68084 WP_000372536.1.6812 WP_000372536.1.6821 WP_000372536.1.68220 WP_000372536.1.68310 WP_000372536.1.68352 WP_000372536.1.68377 WP_000372536.1.68381 WP_000372536.1.68406 WP_000372536.1.68430 WP_000372536.1.68431 WP_000372536.1.68503 WP_000372536.1.68535 WP_000372536.1.68567 WP_000372536.1.68653 WP_000372536.1.68686 WP_000372536.1.68689 WP_000372536.1.68755 WP_000372536.1.68807 WP_000372536.1.68819 WP_000372536.1.68825 WP_000372536.1.68851 WP_000372536.1.68852 WP_000372536.1.6890 WP_000372536.1.68963 WP_000372536.1.690 WP_000372536.1.69037 WP_000372536.1.69052 WP_000372536.1.69063 WP_000372536.1.69073 WP_000372536.1.69149 WP_000372536.1.69234 WP_000372536.1.69241 WP_000372536.1.69246 WP_000372536.1.6925 WP_000372536.1.69285 WP_000372536.1.69292 WP_000372536.1.69321 WP_000372536.1.69326 WP_000372536.1.69399 WP_000372536.1.69416 WP_000372536.1.69428 WP_000372536.1.69431 WP_000372536.1.69499 WP_000372536.1.69500 WP_000372536.1.6961 WP_000372536.1.69623 WP_000372536.1.69641 WP_000372536.1.69668 WP_000372536.1.69670 WP_000372536.1.69687 WP_000372536.1.6969 WP_000372536.1.69715 WP_000372536.1.69731 WP_000372536.1.69739 WP_000372536.1.69757 WP_000372536.1.69797 WP_000372536.1.69850 WP_000372536.1.69866 WP_000372536.1.69869 WP_000372536.1.6988 WP_000372536.1.69905 WP_000372536.1.69911 WP_000372536.1.69917 WP_000372536.1.7 WP_000372536.1.70011 WP_000372536.1.70020 WP_000372536.1.70046 WP_000372536.1.70051 WP_000372536.1.70073 WP_000372536.1.70075 WP_000372536.1.7008 WP_000372536.1.70142 WP_000372536.1.70159 WP_000372536.1.70166 WP_000372536.1.70199 WP_000372536.1.70224 WP_000372536.1.70275 WP_000372536.1.70279 WP_000372536.1.70298 WP_000372536.1.70307 WP_000372536.1.70308 WP_000372536.1.70315 WP_000372536.1.70329 WP_000372536.1.70360 WP_000372536.1.7040 WP_000372536.1.70400 WP_000372536.1.70409 WP_000372536.1.70453 WP_000372536.1.7047 WP_000372536.1.70508 WP_000372536.1.70535 WP_000372536.1.70567 WP_000372536.1.70617 WP_000372536.1.70620 WP_000372536.1.70766 WP_000372536.1.70771 WP_000372536.1.70838 WP_000372536.1.70867 WP_000372536.1.70887 WP_000372536.1.70904 WP_000372536.1.70916 WP_000372536.1.70949 WP_000372536.1.71017 WP_000372536.1.71020 WP_000372536.1.71206 WP_000372536.1.7123 WP_000372536.1.71270 WP_000372536.1.71369 WP_000372536.1.71415 WP_000372536.1.71663 WP_000372536.1.71675 WP_000372536.1.71700 WP_000372536.1.71808 WP_000372536.1.71818 WP_000372536.1.71841 WP_000372536.1.71849 WP_000372536.1.71926 WP_000372536.1.71977 WP_000372536.1.72009 WP_000372536.1.72074 WP_000372536.1.72147 WP_000372536.1.72160 WP_000372536.1.72163 WP_000372536.1.72192 WP_000372536.1.72233 WP_000372536.1.72235 WP_000372536.1.72253 WP_000372536.1.72426 WP_000372536.1.7247 WP_000372536.1.72502 WP_000372536.1.72534 WP_000372536.1.72610 WP_000372536.1.72630 WP_000372536.1.72736 WP_000372536.1.72769 WP_000372536.1.72785 WP_000372536.1.7289 WP_000372536.1.72911 WP_000372536.1.72922 WP_000372536.1.72926 WP_000372536.1.72932 WP_000372536.1.72934 WP_000372536.1.72940 WP_000372536.1.72978 WP_000372536.1.7299 WP_000372536.1.73008 WP_000372536.1.73012 WP_000372536.1.73043 WP_000372536.1.73071 WP_000372536.1.73089 WP_000372536.1.73101 WP_000372536.1.73106 WP_000372536.1.73178 WP_000372536.1.73227 WP_000372536.1.73322 WP_000372536.1.73324 WP_000372536.1.73357 WP_000372536.1.73419 WP_000372536.1.73476 WP_000372536.1.73509 WP_000372536.1.73520 WP_000372536.1.73522 WP_000372536.1.73543 WP_000372536.1.73554 WP_000372536.1.73567 WP_000372536.1.7359 WP_000372536.1.73666 WP_000372536.1.73726 WP_000372536.1.73777 WP_000372536.1.73796 WP_000372536.1.73825 WP_000372536.1.73838 WP_000372536.1.73890 WP_000372536.1.73912 WP_000372536.1.7397 WP_000372536.1.73982 WP_000372536.1.7409 WP_000372536.1.74105 WP_000372536.1.74139 WP_000372536.1.7415 WP_000372536.1.7416 WP_000372536.1.7420 WP_000372536.1.74208 WP_000372536.1.7431 WP_000372536.1.74330 WP_000372536.1.74331 WP_000372536.1.74387 WP_000372536.1.7449 WP_000372536.1.74508 WP_000372536.1.74608 WP_000372536.1.74762 WP_000372536.1.74780 WP_000372536.1.74796 WP_000372536.1.74822 WP_000372536.1.74855 WP_000372536.1.74891 WP_000372536.1.7497 WP_000372536.1.74974 WP_000372536.1.7503 WP_000372536.1.75049 WP_000372536.1.75085 WP_000372536.1.75154 WP_000372536.1.75156 WP_000372536.1.7517 WP_000372536.1.75259 WP_000372536.1.7527 WP_000372536.1.75314 WP_000372536.1.75317 WP_000372536.1.75336 WP_000372536.1.75406 WP_000372536.1.75427 WP_000372536.1.75445 WP_000372536.1.75455 WP_000372536.1.75464 WP_000372536.1.7548 WP_000372536.1.75492 WP_000372536.1.75522 WP_000372536.1.75534 WP_000372536.1.75582 WP_000372536.1.75632 WP_000372536.1.75654 WP_000372536.1.75675 WP_000372536.1.75691 WP_000372536.1.75701 WP_000372536.1.75709 WP_000372536.1.75729 WP_000372536.1.75755 WP_000372536.1.75787 WP_000372536.1.75834 WP_000372536.1.75897 WP_000372536.1.75976 WP_000372536.1.75987 WP_000372536.1.75996 WP_000372536.1.76017 WP_000372536.1.76018 WP_000372536.1.76067 WP_000372536.1.76068 WP_000372536.1.76080 WP_000372536.1.76161 WP_000372536.1.76166 WP_000372536.1.76220 WP_000372536.1.76233 WP_000372536.1.76249 WP_000372536.1.76251 WP_000372536.1.76285 WP_000372536.1.76293 WP_000372536.1.76458 WP_000372536.1.76530 WP_000372536.1.76564 WP_000372536.1.76567 WP_000372536.1.76570 WP_000372536.1.76577 WP_000372536.1.76591 WP_000372536.1.76631 WP_000372536.1.76667 WP_000372536.1.76692 WP_000372536.1.76720 WP_000372536.1.76731 WP_000372536.1.76761 WP_000372536.1.76777 WP_000372536.1.76780 WP_000372536.1.7679 WP_000372536.1.76837 WP_000372536.1.76850 WP_000372536.1.76862 WP_000372536.1.76865 WP_000372536.1.76868 WP_000372536.1.76874 WP_000372536.1.76892 WP_000372536.1.76927 WP_000372536.1.76942 WP_000372536.1.77 WP_000372536.1.77037 WP_000372536.1.77044 WP_000372536.1.7706 WP_000372536.1.77123 WP_000372536.1.77130 WP_000372536.1.77172 WP_000372536.1.77197 WP_000372536.1.77269 WP_000372536.1.77375 WP_000372536.1.77399 WP_000372536.1.77413 WP_000372536.1.77439 WP_000372536.1.77456 WP_000372536.1.77480 WP_000372536.1.77505 WP_000372536.1.77535 WP_000372536.1.77568 WP_000372536.1.77582 WP_000372536.1.77610 WP_000372536.1.77670 WP_000372536.1.77701 WP_000372536.1.77765 WP_000372536.1.77789 WP_000372536.1.77894 WP_000372536.1.77976 WP_000372536.1.77982 WP_000372536.1.78025 WP_000372536.1.78030 WP_000372536.1.78045 WP_000372536.1.78068 WP_000372536.1.78087 WP_000372536.1.7822 WP_000372536.1.7838 WP_000372536.1.78389 WP_000372536.1.78422 WP_000372536.1.78454 WP_000372536.1.78457 WP_000372536.1.7846 WP_000372536.1.78475 WP_000372536.1.78563 WP_000372536.1.78569 WP_000372536.1.78629 WP_000372536.1.78690 WP_000372536.1.78724 WP_000372536.1.7876 WP_000372536.1.78762 WP_000372536.1.78794 WP_000372536.1.78865 WP_000372536.1.78876 WP_000372536.1.78889 WP_000372536.1.78939 WP_000372536.1.79008 WP_000372536.1.79040 WP_000372536.1.79079 WP_000372536.1.79096 WP_000372536.1.79157 WP_000372536.1.7941 WP_000372536.1.7950 WP_000372536.1.79594 WP_000372536.1.79616 WP_000372536.1.79693 WP_000372536.1.79732 WP_000372536.1.79746 WP_000372536.1.79748 WP_000372536.1.79793 WP_000372536.1.79809 WP_000372536.1.79899 WP_000372536.1.79920 WP_000372536.1.79958 WP_000372536.1.79969 WP_000372536.1.80005 WP_000372536.1.80019 WP_000372536.1.8003 WP_000372536.1.80130 WP_000372536.1.80134 WP_000372536.1.80148 WP_000372536.1.80161 WP_000372536.1.80200 WP_000372536.1.80207 WP_000372536.1.80261 WP_000372536.1.80279 WP_000372536.1.80294 WP_000372536.1.80321 WP_000372536.1.80364 WP_000372536.1.80367 WP_000372536.1.80372 WP_000372536.1.80376 WP_000372536.1.80427 WP_000372536.1.80457 WP_000372536.1.80475 WP_000372536.1.8048 WP_000372536.1.80532 WP_000372536.1.80539 WP_000372536.1.80748 WP_000372536.1.80885 WP_000372536.1.80944 WP_000372536.1.80990 WP_000372536.1.8101 WP_000372536.1.81012 WP_000372536.1.81048 WP_000372536.1.81117 WP_000372536.1.81170 WP_000372536.1.81173 WP_000372536.1.81183 WP_000372536.1.81201 WP_000372536.1.81236 WP_000372536.1.81292 WP_000372536.1.81343 WP_000372536.1.8136 WP_000372536.1.81367 WP_000372536.1.81375 WP_000372536.1.81382 WP_000372536.1.81390 WP_000372536.1.81395 WP_000372536.1.81408 WP_000372536.1.81483 WP_000372536.1.81534 WP_000372536.1.81550 WP_000372536.1.81663 WP_000372536.1.81694 WP_000372536.1.81724 WP_000372536.1.81733 WP_000372536.1.81775 WP_000372536.1.818 WP_000372536.1.81929 WP_000372536.1.82094 WP_000372536.1.82189 WP_000372536.1.82212 WP_000372536.1.82297 WP_000372536.1.82342 WP_000372536.1.82345 WP_000372536.1.82422 WP_000372536.1.82423 WP_000372536.1.82459 WP_000372536.1.82463 WP_000372536.1.82502 WP_000372536.1.82518 WP_000372536.1.82552 WP_000372536.1.8257 WP_000372536.1.82650 WP_000372536.1.82660 WP_000372536.1.82733 WP_000372536.1.82771 WP_000372536.1.82777 WP_000372536.1.82792 WP_000372536.1.82818 WP_000372536.1.82839 WP_000372536.1.82847 WP_000372536.1.82877 WP_000372536.1.82885 WP_000372536.1.82900 WP_000372536.1.82911 WP_000372536.1.82921 WP_000372536.1.82929 WP_000372536.1.8293 WP_000372536.1.82958 WP_000372536.1.82970 WP_000372536.1.82994 WP_000372536.1.83064 WP_000372536.1.83067 WP_000372536.1.83094 WP_000372536.1.83135 WP_000372536.1.83136 WP_000372536.1.83158 WP_000372536.1.8316 WP_000372536.1.83169 WP_000372536.1.83227 WP_000372536.1.83239 WP_000372536.1.83242 WP_000372536.1.83244 WP_000372536.1.83278 WP_000372536.1.83306 WP_000372536.1.83371 WP_000372536.1.83403 WP_000372536.1.83414 WP_000372536.1.83439 WP_000372536.1.83455 WP_000372536.1.83456 WP_000372536.1.83489 WP_000372536.1.83518 WP_000372536.1.8352 WP_000372536.1.83565 WP_000372536.1.83574 WP_000372536.1.83578 WP_000372536.1.83585 WP_000372536.1.83702 WP_000372536.1.83713 WP_000372536.1.83726 WP_000372536.1.83730 WP_000372536.1.83776 WP_000372536.1.83789 WP_000372536.1.83790 WP_000372536.1.83846 WP_000372536.1.83888 WP_000372536.1.83910 WP_000372536.1.8392 WP_000372536.1.83961 WP_000372536.1.83964 WP_000372536.1.84013 WP_000372536.1.84017 WP_000372536.1.84044 WP_000372536.1.84052 WP_000372536.1.84065 WP_000372536.1.84095 WP_000372536.1.84111 WP_000372536.1.84116 WP_000372536.1.84147 WP_000372536.1.84175 WP_000372536.1.84213 WP_000372536.1.84225 WP_000372536.1.84263 WP_000372536.1.84305 WP_000372536.1.84321 WP_000372536.1.84353 WP_000372536.1.84444 WP_000372536.1.8454 WP_000372536.1.84576 WP_000372536.1.84633 WP_000372536.1.84640 WP_000372536.1.84643 WP_000372536.1.84672 WP_000372536.1.84931 WP_000372536.1.8500 WP_000372536.1.85033 WP_000372536.1.85061 WP_000372536.1.85095 WP_000372536.1.85103 WP_000372536.1.85114 WP_000372536.1.85123 WP_000372536.1.85171 WP_000372536.1.85221 WP_000372536.1.8524 WP_000372536.1.85286 WP_000372536.1.85373 WP_000372536.1.85427 WP_000372536.1.85434 WP_000372536.1.85508 WP_000372536.1.85509 WP_000372536.1.85608 WP_000372536.1.85613 WP_000372536.1.85659 WP_000372536.1.85661 WP_000372536.1.85697 WP_000372536.1.85718 WP_000372536.1.8574 WP_000372536.1.85760 WP_000372536.1.85789 WP_000372536.1.85849 WP_000372536.1.85881 WP_000372536.1.85907 WP_000372536.1.86075 WP_000372536.1.86081 WP_000372536.1.86118 WP_000372536.1.86296 WP_000372536.1.86300 WP_000372536.1.86313 WP_000372536.1.86360 WP_000372536.1.86407 WP_000372536.1.86423 WP_000372536.1.86445 WP_000372536.1.8646 WP_000372536.1.86529 WP_000372536.1.86558 WP_000372536.1.86559 WP_000372536.1.86612 WP_000372536.1.86614 WP_000372536.1.86632 WP_000372536.1.86655 WP_000372536.1.86721 WP_000372536.1.86724 WP_000372536.1.86747 WP_000372536.1.86939 WP_000372536.1.86996 WP_000372536.1.87069 WP_000372536.1.87073 WP_000372536.1.87077 WP_000372536.1.87118 WP_000372536.1.87135 WP_000372536.1.87160 WP_000372536.1.87174 WP_000372536.1.87200 WP_000372536.1.8724 WP_000372536.1.87289 WP_000372536.1.87317 WP_000372536.1.87347 WP_000372536.1.87352 WP_000372536.1.87375 WP_000372536.1.87383 WP_000372536.1.8744 WP_000372536.1.87510 WP_000372536.1.87550 WP_000372536.1.87621 WP_000372536.1.87719 WP_000372536.1.87774 WP_000372536.1.87815 WP_000372536.1.87824 WP_000372536.1.87901 WP_000372536.1.87909 WP_000372536.1.87910 WP_000372536.1.87969 WP_000372536.1.87971 WP_000372536.1.87998 WP_000372536.1.88008 WP_000372536.1.88054 WP_000372536.1.88084 WP_000372536.1.88167 WP_000372536.1.88170 WP_000372536.1.88176 WP_000372536.1.88224 WP_000372536.1.88228 WP_000372536.1.88232 WP_000372536.1.883 WP_000372536.1.88391 WP_000372536.1.88428 WP_000372536.1.88488 WP_000372536.1.88544 WP_000372536.1.88586 WP_000372536.1.88652 WP_000372536.1.88669 WP_000372536.1.88693 WP_000372536.1.88697 WP_000372536.1.88699 WP_000372536.1.88724 WP_000372536.1.88825 WP_000372536.1.88841 WP_000372536.1.88862 WP_000372536.1.88869 WP_000372536.1.88904 WP_000372536.1.88932 WP_000372536.1.88939 WP_000372536.1.88940 WP_000372536.1.88984 WP_000372536.1.89034 WP_000372536.1.89123 WP_000372536.1.89210 WP_000372536.1.89254 WP_000372536.1.89370 WP_000372536.1.89446 WP_000372536.1.89525 WP_000372536.1.89532 WP_000372536.1.8973 WP_000372536.1.8975 WP_000372536.1.89793 WP_000372536.1.89806 WP_000372536.1.89837 WP_000372536.1.89850 WP_000372536.1.89858 WP_000372536.1.89875 WP_000372536.1.89887 WP_000372536.1.89891 WP_000372536.1.89930 WP_000372536.1.89982 WP_000372536.1.90010 WP_000372536.1.90028 WP_000372536.1.90035 WP_000372536.1.90053 WP_000372536.1.90113 WP_000372536.1.90119 WP_000372536.1.90124 WP_000372536.1.90143 WP_000372536.1.90158 WP_000372536.1.90166 WP_000372536.1.90178 WP_000372536.1.9018 WP_000372536.1.90192 WP_000372536.1.9027 WP_000372536.1.90313 WP_000372536.1.90385 WP_000372536.1.90396 WP_000372536.1.90410 WP_000372536.1.9045 WP_000372536.1.90463 WP_000372536.1.90486 WP_000372536.1.90529 WP_000372536.1.90565 WP_000372536.1.90572 WP_000372536.1.90615 WP_000372536.1.90618 WP_000372536.1.90628 WP_000372536.1.90712 WP_000372536.1.90809 WP_000372536.1.90894 WP_000372536.1.90970 WP_000372536.1.90989 WP_000372536.1.91041 WP_000372536.1.91052 WP_000372536.1.91127 WP_000372536.1.9115 WP_000372536.1.91178 WP_000372536.1.91369 WP_000372536.1.91388 WP_000372536.1.91407 WP_000372536.1.91412 WP_000372536.1.91432 WP_000372536.1.91478 WP_000372536.1.91481 WP_000372536.1.91562 WP_000372536.1.9162 WP_000372536.1.91653 WP_000372536.1.91705 WP_000372536.1.91714 WP_000372536.1.9173 WP_000372536.1.91775 WP_000372536.1.91808 WP_000372536.1.91811 WP_000372536.1.91821 WP_000372536.1.9184 WP_000372536.1.91902 WP_000372536.1.9192 WP_000372536.1.91934 WP_000372536.1.91947 WP_000372536.1.91949 WP_000372536.1.91985 WP_000372536.1.92006 WP_000372536.1.92015 WP_000372536.1.92027 WP_000372536.1.9207 WP_000372536.1.92077 WP_000372536.1.92103 WP_000372536.1.92124 WP_000372536.1.92167 WP_000372536.1.92176 WP_000372536.1.92177 WP_000372536.1.92178 WP_000372536.1.92225 WP_000372536.1.92248 WP_000372536.1.92261 WP_000372536.1.92298 WP_000372536.1.92301 WP_000372536.1.92326 WP_000372536.1.92342 WP_000372536.1.92353 WP_000372536.1.92369 WP_000372536.1.92386 WP_000372536.1.92457 WP_000372536.1.92491 WP_000372536.1.9260 WP_000372536.1.92631 WP_000372536.1.92656 WP_000372536.1.92682 WP_000372536.1.92740 WP_000372536.1.92814 WP_000372536.1.92872 WP_000372536.1.92874 WP_000372536.1.92878 WP_000372536.1.92896 WP_000372536.1.92913 WP_000372536.1.92962 WP_000372536.1.92973 WP_000372536.1.9299 WP_000372536.1.93021 WP_000372536.1.93075 WP_000372536.1.93108 WP_000372536.1.93126 WP_000372536.1.93173 WP_000372536.1.93183 WP_000372536.1.93202 WP_000372536.1.9326 WP_000372536.1.93262 WP_000372536.1.93294 WP_000372536.1.93311 WP_000372536.1.93314 WP_000372536.1.93347 WP_000372536.1.9339 WP_000372536.1.93401 WP_000372536.1.9345 WP_000372536.1.93452 WP_000372536.1.93462 WP_000372536.1.93475 WP_000372536.1.93522 WP_000372536.1.93525 WP_000372536.1.93606 WP_000372536.1.93609 WP_000372536.1.9364 WP_000372536.1.9369 WP_000372536.1.93696 WP_000372536.1.93700 WP_000372536.1.93703 WP_000372536.1.93869 WP_000372536.1.93910 WP_000372536.1.93947 WP_000372536.1.93982 WP_000372536.1.94029 WP_000372536.1.94098 WP_000372536.1.9414 WP_000372536.1.94157 WP_000372536.1.94170 WP_000372536.1.94263 WP_000372536.1.94269 WP_000372536.1.9429 WP_000372536.1.943 WP_000372536.1.94395 WP_000372536.1.94425 WP_000372536.1.94459 WP_000372536.1.94469 WP_000372536.1.9452 WP_000372536.1.94539 WP_000372536.1.94570 WP_000372536.1.94595 WP_000372536.1.94610 WP_000372536.1.94644 WP_000372536.1.94711 WP_000372536.1.94724 WP_000372536.1.94771 WP_000372536.1.94778 WP_000372536.1.94810 WP_000372536.1.94876 WP_000372536.1.94940 WP_000372536.1.95050 WP_000372536.1.95059 WP_000372536.1.95128 WP_000372536.1.95177 WP_000372536.1.9528 WP_000372536.1.95321 WP_000372536.1.95333 WP_000372536.1.95356 WP_000372536.1.95369 WP_000372536.1.95376 WP_000372536.1.95413 WP_000372536.1.95531 WP_000372536.1.95605 WP_000372536.1.95642 WP_000372536.1.95698 WP_000372536.1.95762 WP_000372536.1.95853 WP_000372536.1.95870 WP_000372536.1.95904 WP_000372536.1.9592 WP_000372536.1.95942 WP_000372536.1.95968 WP_000372536.1.95998 WP_000372536.1.96011 WP_000372536.1.96103 WP_000372536.1.96106 WP_000372536.1.96120 WP_000372536.1.96126 WP_000372536.1.96178 WP_000372536.1.96181 WP_000372536.1.9620 WP_000372536.1.9621 WP_000372536.1.96227 WP_000372536.1.96292 WP_000372536.1.96309 WP_000372536.1.96436 WP_000372536.1.96464 WP_000372536.1.96466 WP_000372536.1.96487 WP_000372536.1.96517 WP_000372536.1.96582 WP_000372536.1.966 WP_000372536.1.96619 WP_000372536.1.96629 WP_000372536.1.96636 WP_000372536.1.96694 WP_000372536.1.96703 WP_000372536.1.96713 WP_000372536.1.96772 WP_000372536.1.96781 WP_000372536.1.96812 WP_000372536.1.96833 WP_000372536.1.96873 WP_000372536.1.96887 WP_000372536.1.96888 WP_000372536.1.96913 WP_000372536.1.96939 WP_000372536.1.96994 WP_000372536.1.97040 WP_000372536.1.97048 WP_000372536.1.9705 WP_000372536.1.97091 WP_000372536.1.97158 WP_000372536.1.97182 WP_000372536.1.97210 WP_000372536.1.9730 WP_000372536.1.97381 WP_000372536.1.97383 WP_000372536.1.97442 WP_000372536.1.97476 WP_000372536.1.9750 WP_000372536.1.97553 WP_000372536.1.97595 WP_000372536.1.97644 WP_000372536.1.97658 WP_000372536.1.97702 WP_000372536.1.97733 WP_000372536.1.97808 WP_000372536.1.97824 WP_000372536.1.97856 WP_000372536.1.97862 WP_000372536.1.97875 WP_000372536.1.97876 WP_000372536.1.97879 WP_000372536.1.97886 WP_000372536.1.97891 WP_000372536.1.97901 WP_000372536.1.97921 WP_000372536.1.97931 WP_000372536.1.97980 WP_000372536.1.98044 WP_000372536.1.98045 WP_000372536.1.98049 WP_000372536.1.98062 WP_000372536.1.98074 WP_000372536.1.9812 WP_000372536.1.98217 WP_000372536.1.98234 WP_000372536.1.98265 WP_000372536.1.98270 WP_000372536.1.98286 WP_000372536.1.98290 WP_000372536.1.98319 WP_000372536.1.98376 WP_000372536.1.98427 WP_000372536.1.98435 WP_000372536.1.98449 WP_000372536.1.98460 WP_000372536.1.98475 WP_000372536.1.98504 WP_000372536.1.98518 WP_000372536.1.98623 WP_000372536.1.98632 WP_000372536.1.98647 WP_000372536.1.98648 WP_000372536.1.9868 WP_000372536.1.98714 WP_000372536.1.98755 WP_000372536.1.98759 WP_000372536.1.98799 WP_000372536.1.98833 WP_000372536.1.98851 WP_000372536.1.98915 WP_000372536.1.9895 WP_000372536.1.98957 WP_000372536.1.99010 WP_000372536.1.99028 WP_000372536.1.99066 WP_000372536.1.99096 WP_000372536.1.99126 WP_000372536.1.99223 WP_000372536.1.99225 WP_000372536.1.99314 WP_000372536.1.99342 WP_000372536.1.99356 WP_000372536.1.99371 WP_000372536.1.99382 WP_000372536.1.99387 WP_000372536.1.99554 WP_000372536.1.99574 WP_000372536.1.99589 WP_000372536.1.99593 WP_000372536.1.99606 WP_000372536.1.99610 WP_000372536.1.99649 WP_000372536.1.9969 WP_000372536.1.997 WP_000372536.1.99787 WP_000372536.1.99793 WP_000372536.1.99839 WP_000372536.1.999 488222.SPJ_0301 516950.SPCG_0305 gi|298502110|ref|YP_003724050.1| gi|307126510|ref|YP_003878541.1| gi|182683275|ref|YP_001835022.1| gi|225853891|ref|YP_002735403.1| gi|387758645|ref|YP_006065623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]