SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392429796|ref|YP_006470841.1| from Mycoplasma bovis HB0801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392429796|ref|YP_006470841.1|
Domain Number 1 Region: 86-288
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 6.59e-25
Family Endonuclease I 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392429796|ref|YP_006470841.1|
Sequence length 314
Comment Endonuclease I [Mycoplasma bovis HB0801]
Sequence
MMNSKMIKHKFLVSLGLISAPVLSLTVLSSTGCNNKNSTTDDNYLIPEKSFYEKSNYYDS
LEGLNGNKLYSELIKIQHNHLSGIKSYRYLKTIYKDAFKDLYYEKDGSLLDIYSENPIGK
DPYNYSFNDSGSSAKSEGLGFNREHLVPQSWFKREKLARQDAHHVWPADILVNNKRDNYP
FGKVTNAIFTSKNGTKIDSYLAEPIDEFKGDIARAHLYFAITHASRYKMHNKGNEVFKFF
DNKPLVNKYFDTYTKWAKKDQINLFDIVRNNEIAKHQNGLRNPFSDYPELIDLIINPGNK
VFVNKGILKSNIAV
Download sequence
Identical sequences A0A059Y851 A0A2D2AQM9
gi|339320724|ref|YP_004683246.1| gi|392429796|ref|YP_006470841.1| WP_013954646.1.102037 WP_013954646.1.21240 WP_013954646.1.32249 WP_013954646.1.32703 WP_013954646.1.37991 WP_013954646.1.49663 WP_013954646.1.50201 WP_013954646.1.8756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]