SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392429915|ref|YP_006470960.1| from Mycoplasma bovis HB0801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392429915|ref|YP_006470960.1|
Domain Number 1 Region: 6-205
Classification Level Classification E-value
Superfamily DhaL-like 7.06e-42
Family DhaL-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|392429915|ref|YP_006470960.1|
Domain Number - Region: 361-530
Classification Level Classification E-value
Superfamily DAK1/DegV-like 0.0314
Family DegV-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392429915|ref|YP_006470960.1|
Sequence length 548
Comment hypothetical protein Mbov_0331 [Mycoplasma bovis HB0801]
Sequence
MIKNAKVIDGTIYSNLIISGANNLINNKNRIDALNVFPVPDGDTGTNMSNTAEAAAKALK
DLQENKNLAEVSAIVSKNMLLGARGNSGVILSQIFKGFANYFADKNEVTVLEFVQGFQSA
TKRAYESVLKPVEGTILTVIRETSEQLAKNVNDETTLEQFFEMAKNYSRVACDNTPNLLK
VLREVGVVDSGGEGLVSFITGMHSYVIGNPVQIQQVEQSIDKFISSDEVYKGEFGYCTEF
IIELSKPDEFDKTAFEKHISKFANSLVIVQDAELIKVHGHTLKPGDMLNYGQKYGEFIKI
KSENMTLQAENSRSNRNNSVVINDVVAQGAKKCGIVSCNLGSGFINKMKELGVDAIIECG
QTQNPSVTDILEAIKSVDAKDVFVLPNNPNIFLAAQQAASGIFDKNVHIVPTRTQIQGIN
AIIAFNSNSSSDENNELMKEVMKMVRTGEVTMAVRDTTLNGVKIKKDNFISILDGKIISC
KSSYLEAAKHLIKKAANDETEIITIYYGNDASEPDAIELVDYINRYYDCEVELVNGNQPN
YHFLIGFE
Download sequence
Identical sequences A0A059Y897 A0A2D2AR13 E4Q077
WP_013456558.1.102037 WP_013456558.1.14198 WP_013456558.1.17077 WP_013456558.1.2028 WP_013456558.1.21240 WP_013456558.1.2669 WP_013456558.1.27818 WP_013456558.1.32249 WP_013456558.1.32382 WP_013456558.1.32703 WP_013456558.1.37991 WP_013456558.1.47380 WP_013456558.1.49663 WP_013456558.1.50201 WP_013456558.1.56049 WP_013456558.1.56372 WP_013456558.1.59238 WP_013456558.1.61074 WP_013456558.1.61437 WP_013456558.1.67253 WP_013456558.1.67779 WP_013456558.1.72194 WP_013456558.1.72927 WP_013456558.1.82377 WP_013456558.1.85199 WP_013456558.1.85958 WP_013456558.1.8756 WP_013456558.1.88257 WP_013456558.1.95878 gi|392429915|ref|YP_006470960.1| gi|339320835|ref|YP_004683357.1| gi|313678611|ref|YP_004056351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]