SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392430156|ref|YP_006471201.1| from Mycoplasma bovis HB0801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392430156|ref|YP_006471201.1|
Domain Number 1 Region: 159-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-48
Family G proteins 0.00000928
Further Details:      
 
Domain Number 2 Region: 3-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.07e-44
Family Obg GTP-binding protein N-terminal domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 348-419
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 4.71e-17
Family Obg GTP-binding protein C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392430156|ref|YP_006471201.1|
Sequence length 422
Comment GTP-binding protein [Mycoplasma bovis HB0801]
Sequence
MAKFIDEIKLTLIAGKGGDGIISFRREAHVDKGGPDGGDGGKGGNIYFVGDKGKNTLLSL
YGNKQISAEDGINGGPKNLYGATGKSTYVKVPIGTMVYKNNKLVADIVEEKEYLVAQGGI
GGRGNAKFKSSRNTAPRICENGTPGEKYLAHIVLKVMSDVGIIGKPSAGKSTLLSAISNA
KAKIAEYEFTTLVPQLGLVKYHDHSFTVADLPGLIKGASEGKGLGIQFLRHIERCRVVVQ
IIDFGSDEKNPIEDFEVINKELEEYSKKLASKAKVVVANKSDLQGFRERVDAFKAKYPDV
DVVEISAIERSNLDELKGKIWKVLEETKMAPTEEDDEEESVVEIKLEEDYKISNPYAGFF
EITGPKIEQIYHKIPLVSYDNLIRFNTMLKKIGVWDDLLKYDIKPGDTVRILEYEFEWDG
EF
Download sequence
Identical sequences A0A059Y432 A0A2D2ARN9
gi|339321075|ref|YP_004683597.1| WP_013954914.1.102037 WP_013954914.1.14198 WP_013954914.1.17077 WP_013954914.1.2028 WP_013954914.1.21240 WP_013954914.1.2669 WP_013954914.1.27818 WP_013954914.1.32249 WP_013954914.1.32382 WP_013954914.1.32703 WP_013954914.1.37991 WP_013954914.1.47380 WP_013954914.1.49663 WP_013954914.1.50201 WP_013954914.1.56049 WP_013954914.1.56372 WP_013954914.1.59238 WP_013954914.1.61074 WP_013954914.1.61437 WP_013954914.1.67253 WP_013954914.1.67779 WP_013954914.1.72927 WP_013954914.1.82377 WP_013954914.1.85199 WP_013954914.1.85958 WP_013954914.1.8756 WP_013954914.1.88257 WP_013954914.1.95878 gi|392430156|ref|YP_006471201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]