SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392430202|ref|YP_006471247.1| from Mycoplasma bovis HB0801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392430202|ref|YP_006471247.1|
Domain Number 1 Region: 7-84,176-352
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.08e-59
Family Bacterial dinuclear zinc exopeptidases 0.0000622
Further Details:      
 
Domain Number 2 Region: 74-184
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 5.8e-24
Family Aminopeptidase/glucanase lid domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392430202|ref|YP_006471247.1|
Sequence length 361
Comment endoglucanase [Mycoplasma bovis HB0801]
Sequence
MSKYDELKTKLVQYMSIEAMSRYEEPVVKQLKENIKSENFEFSRDGFGSLIITKKSKVAN
APKVMIAAHMDEVGYLVRNIEDNGNLLVSSVGGIWPTAVIGTKAKVVINKDNKEAIGVFG
HTSIHILEAEKRTKAPLEKELFVDCGFLNKQEAIDFGIEVGDRVYMSGETIELRNDLLGG
KAMDNRAGVTVIDMLANRIKDIDLPNDLYLVGSVQEEVGCRGAKTSVSLINPDVAFAIDT
GASHDTTGCIKGVPSLGKGVALLIQDSAVMTDPKLVNILTKIAQEKDIPVYKYIAEGGGT
DGAVLQYGIGGVPTITLSIPQRYLHSPIGVASLVDIQATLDLITEFVKVFDNNKNAELHS
S
Download sequence
Identical sequences A0A2D2ART3
WP_013954939.1.102037 WP_013954939.1.14198 WP_013954939.1.17077 WP_013954939.1.21240 WP_013954939.1.2669 WP_013954939.1.27818 WP_013954939.1.32249 WP_013954939.1.32382 WP_013954939.1.37991 WP_013954939.1.47380 WP_013954939.1.49663 WP_013954939.1.50201 WP_013954939.1.56049 WP_013954939.1.56372 WP_013954939.1.59238 WP_013954939.1.61074 WP_013954939.1.67253 WP_013954939.1.67779 WP_013954939.1.82377 WP_013954939.1.85199 WP_013954939.1.85958 WP_013954939.1.8756 WP_013954939.1.88257 WP_013954939.1.95878 gi|392430202|ref|YP_006471247.1| gi|339321120|ref|YP_004683642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]