SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392430256|ref|YP_006471301.1| from Mycoplasma bovis HB0801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392430256|ref|YP_006471301.1|
Domain Number 1 Region: 6-84,176-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.82e-57
Family Bacterial dinuclear zinc exopeptidases 0.0000481
Further Details:      
 
Domain Number 2 Region: 74-184
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.66e-25
Family Aminopeptidase/glucanase lid domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392430256|ref|YP_006471301.1|
Sequence length 362
Comment endoglucanase [Mycoplasma bovis HB0801]
Sequence
MNKGEFKNRLVKYLEAEGISRYESNIAKMMEAEINKNNCFTVSYDNFGSIIFHKKSKFLN
APKFMVAAHMDEVGFLVKGIHENGQIKLSSVGGLWPSVVIGTKAVLINSNGKRFNGVFGH
TSIHIMEAEKRSKALTMNDLYADFGFFSEQEAKDNGIEVGNVVLMTGETVYLDNPDLLAG
KAMDNRAGVCVLEHIAKELENEDLGVDLYLVGTVQEEVGTRGAKTSVSLINPEFAIALDT
TSTHDTIGTIPGTTKIGNGAAIRIKDGGMMANPQLVEFMCRIGRKNNIKHYKFISMGGGT
DAAELQYAKGGAITLTISLPQRYLHSPIGLISINDLIESTKLITETIKAINADVYATIFK
YK
Download sequence
Identical sequences A0A059Y945 A0A2D2ART9
gi|392430256|ref|YP_006471301.1| gi|339321177|ref|YP_004683699.1| WP_013954986.1.102037 WP_013954986.1.14198 WP_013954986.1.17077 WP_013954986.1.2028 WP_013954986.1.21240 WP_013954986.1.2669 WP_013954986.1.27818 WP_013954986.1.32249 WP_013954986.1.32382 WP_013954986.1.32703 WP_013954986.1.37991 WP_013954986.1.47380 WP_013954986.1.49663 WP_013954986.1.50201 WP_013954986.1.56049 WP_013954986.1.56372 WP_013954986.1.59238 WP_013954986.1.61074 WP_013954986.1.61437 WP_013954986.1.67253 WP_013954986.1.67779 WP_013954986.1.72927 WP_013954986.1.82377 WP_013954986.1.85199 WP_013954986.1.85958 WP_013954986.1.8756 WP_013954986.1.88257 WP_013954986.1.95878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]