SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392430286|ref|YP_006471331.1| from Mycoplasma bovis HB0801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392430286|ref|YP_006471331.1|
Domain Number 1 Region: 7-153
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.84e-31
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392430286|ref|YP_006471331.1|
Sequence length 162
Comment ascorbate-specific PTS system enzyme II Ccomponent [Mycoplasma bovis HB0801]
Sequence
MADKLNLLDNLIANDSIIVGYEAKDYKDAIHKSCEPLVNKGIINFNYYDSILKSTEAHGP
YYILVDGIAMPHASATENSVFSNGFSLLTLKKPITFANDPREVKIVMTLAAKDGETHTAV
AIPQIIAVFEDPNNIDKIASAKSKEEVIEIIKSVDYTKYMSN
Download sequence
Identical sequences A0A059Y9A0 A0A2D2ARX4 E4Q0Q0
gi|339321207|ref|YP_004683729.1| WP_013456314.1.102037 WP_013456314.1.14198 WP_013456314.1.17077 WP_013456314.1.21240 WP_013456314.1.2669 WP_013456314.1.27818 WP_013456314.1.32249 WP_013456314.1.32382 WP_013456314.1.32703 WP_013456314.1.37991 WP_013456314.1.47380 WP_013456314.1.49663 WP_013456314.1.50201 WP_013456314.1.56049 WP_013456314.1.56372 WP_013456314.1.59238 WP_013456314.1.61074 WP_013456314.1.67253 WP_013456314.1.67779 WP_013456314.1.72194 WP_013456314.1.82377 WP_013456314.1.85199 WP_013456314.1.85958 WP_013456314.1.8756 WP_013456314.1.88257 WP_013456314.1.95878 gi|313678784|ref|YP_004056524.1| gi|392430286|ref|YP_006471331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]