SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383756672|ref|YP_005435657.1| from Rubrivivax gelatinosus IL144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383756672|ref|YP_005435657.1|
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.31e-33
Family Frataxin-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383756672|ref|YP_005435657.1|
Sequence length 111
Comment hypothetical protein RGE_08150 [Rubrivivax gelatinosus IL144]
Sequence
MSTVLTDAEYHRLAQEALARIEATADRLLQQDVVDIDTTRTGGLLELSFPNGSKIVVNTQ
PPLQELWLAARGGGFHYRWVDGRWADTRDGSEFFAALSEHASTQAGKPVVF
Download sequence
Identical sequences I0HMC1
gi|383756672|ref|YP_005435657.1| WP_014427031.1.65014 WP_014427031.1.89159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]