SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383756904|ref|YP_005435889.1| from Rubrivivax gelatinosus IL144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383756904|ref|YP_005435889.1|
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.35e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000228
Further Details:      
 
Domain Number 2 Region: 358-456
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.31e-18
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00096
Further Details:      
 
Domain Number 3 Region: 293-333
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000000763
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383756904|ref|YP_005435889.1|
Sequence length 466
Comment cytochrome b PetB [Rubrivivax gelatinosus IL144]
Sequence
MAEFKQARPGAPMAEQFMTWVDNRFPATKLFKEHMSEYYAPKNFNVWYFFGSLAMLVLVI
QIVTGIFLVMHYKPDAAVAFASVEYIMRDVPWGWLVRYMHSTGASAFFIVVYLHMFRGMI
YGSYRKPRELVWIFGCAIFLALMAEAFMGYLLPWGQMSYWGAQVIINLFSAIPFVGNDLS
LLIRGDFVVGDATLNRFFSFHVIAVPLVLLGLVVAHIIALHEVGSNNPDGIEIKALKDDK
GIPLDGIPFHPYYTVHDIYGVAIFLILYSAVLFFAPEGGGYFLEFNNFIPADPLKTPAHI
APVWYFTPFYSMLRAVTDDMVTVLVVLIAIAGVLGFVKGGFKGIWKFAPLVGAIVLVALL
KTFDAKFWGVVVMGVAVLILFFLPWLDRSPVKSIRYRPAWHKAVYAVFVVNFLVLGYYGI
QPPSAAGSIISMVGTLFYMGFFLLMPWWSRIGEFKPVPERVTFRAH
Download sequence
Identical sequences I0HN03
gi|383756904|ref|YP_005435889.1| WP_014427261.1.65014 WP_014427261.1.89159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]