SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10005866|PACid:23176930 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10005866|PACid:23176930
Domain Number 1 Region: 23-97
Classification Level Classification E-value
Superfamily TSP9-like 9.15e-22
Family TSP9-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10005866|PACid:23176930
Sequence length 97
Sequence
MASLLPISFRPPTVRVYATKGSAAAGKSNEEKGLLDFILGGLTKQDQFYETDPILKKVED
TNGGAGTGTTSGRKNTVVIPQTKKNGTTGFGGLFAKK
Download sequence
Identical sequences Lus10001204|PACid:23173055 Lus10005866|PACid:23176930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]