SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lus10009855|PACid:23180156 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10009855|PACid:23180156
Domain Number 1 Region: 8-155
Classification Level Classification E-value
Superfamily At5g01610-like 4.45e-41
Family At5g01610-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10009855|PACid:23180156
Sequence length 162
Sequence
MESSAICTLLFAAAALFSTTTASTYPLDGGGGGTTLTAYQVLQQYDFPVGILPKGISGYE
IDTETGKFKAYLQQNCKFTIQSYQLEYGTTISGVISKGRISNLKGVKVHILFLWLNIVEV
VHDGGEMQFSVGITSANFPLDGFDESPQCGCGFDCDGLVSSI
Download sequence
Identical sequences Lus10009855|PACid:23180156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]