SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10018216|PACid:23179383 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10018216|PACid:23179383
Domain Number 1 Region: 18-67
Classification Level Classification E-value
Superfamily TSP9-like 0.0000000000000301
Family TSP9-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10018216|PACid:23179383
Sequence length 127
Sequence
MASLPISFATTQVFAATAAKGSGGSKEEKGPWDWIVGNLIKEDQFYETDPILNKTEEKSG
GGGERCRRGNERTGGTDCRQXXXSVELLPAGKAPLSQFPRRRRAALVASSPRIDDESVIK
KNHTQIY
Download sequence
Identical sequences Lus10018216|PACid:23179383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]