SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10022920|PACid:23159951 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10022920|PACid:23159951
Domain Number 1 Region: 276-309
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000432
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10022920|PACid:23159951
Sequence length 317
Sequence
MANSGGHRTNPDFSRQGKQGFSRGNNRYSQNEDRNMDDDDDDEDELLMPLKNGVYFNQKS
QSTAAPGEREKEIIELFKKVQVLLREKAGVKTEKKVEPSSPQGKVPKETETVGSLLNLLR
KHSNVSKEDSSSDHRKNSSFSKEDSSGDQLEQTWGNNEDYKSSSSGGVHSVNKYSNGAVD
STAASFARPPSSFRKRTPFMRTTMPPPPPPRVDSSNGEDYVTSKTRSNSSGGKKEEYEVI
PDAIHEPGDEHGSEMLLAELDDDSGEDEEHDADDDVEDLSSMKITELKQLAKARGIKRYS
KMNKSELVEVLSGGSSD
Download sequence
Identical sequences Lus10022920|PACid:23159951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]