SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10024898|PACid:23178902 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Lus10024898|PACid:23178902
Domain Number - Region: 328-361
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000173
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10024898|PACid:23178902
Sequence length 369
Sequence
MPAESYGPLDGSCLSLSGFSQRPAAVCVSPCSSHGGFFSHIKIRSTGTPSFICMANSGGH
RTNPDFSRQGKQGFSRGNNRYSQNEDRNMDDDDDDEDELLMPLKNGVYFNQKSQSTAAPG
EREKEIIELFKKVQVLLREKAGVKTEKKVEPSPQGKVSKETETVGSLLNLLRKHSNVSKE
DSSSDHRKNSSFSKEDTSGDQLEQTWGNNEDYKSSGSGGLHSVNKYSNGAVDSSSAPFTR
PPSSFRKRTPFMRTTMPPPPPPQVDSSNEEDHVTSKSRSNSSGAKKEEYEVIPDAIHEPE
DDHGSEMLLAELDDDSGEEDEEHEADDVEDLSSLKITELKQLAKARGIKRYSKMNKSELV
EVLSGGSSD
Download sequence
Identical sequences Lus10024898|PACid:23178902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]