SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10027750|PACid:23156930 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10027750|PACid:23156930
Domain Number 1 Region: 107-222
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000000432
Family N-utilization substance G protein NusG, N-terminal domain 0.0047
Further Details:      
 
Domain Number 2 Region: 265-316
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000612
Family N-utilization substance G protein NusG, C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10027750|PACid:23156930
Sequence length 323
Sequence
MMNEGLVLQWSSRRYYYCHRNTIAPPSLRFPETKRICRPLIRASTTEGQQLTAKDRRQVR
NQRRESKSGYSWREEVEERLSMKTKKNVIRKKDELSLDRLAELGPQWWGLKTAMTRGHLT
ADVVAKSLARKYPELEFKMYAPSVQIKRRLKSGNISTKLQPIFPGTVFLCCVLNKEIHDF
VYGCRGVGGFVGIKVGYMGRLYNIPRQVSKEDIQKVVKRAEEEQEKHDQAFEEEEQARRV
EDSSKKLKAKDTVKESSKKKKVSKRLSAGSIVRVQSGPFAEFQGSLKKVHRKTGKATVGF
TLFGKETLVELDLNEIVTEAASI
Download sequence
Identical sequences Lus10027750|PACid:23156930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]