SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10035543|PACid:23147644 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10035543|PACid:23147644
Domain Number 1 Region: 107-222
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0000000000458
Family N-utilization substance G protein NusG, N-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 265-316
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000331
Family N-utilization substance G protein NusG, C-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10035543|PACid:23147644
Sequence length 324
Sequence
MMNEGLVLQWSSSRYYCCNRNTIAPPSLRFPGTKRICRPLIRASTTEEQQLTAKDRRQLR
NQRRESKSGYSWREEVEERLSMKTKKNVIRKKDELSLDRLAELGPQWWGLKTAMTRGHLT
ADVVAKSLARKYPEFEFKMYAPSVQIKRKLKSGKISTKLQPIFPGTVFLCCVLNKEIHDF
VYGCRGVGGFVGIKVGYMGRLYNIPRQVSEEDIQQVVKRAEEEQEKHDQAFEEEEQARRV
EESSKKLKAKDTVKESSKKKKVSKRLSAGSIVRVQSGPFAEFEGSLKKVHRKTGKATVGF
TLFGKETLVELDLNEIVTEEAASI
Download sequence
Identical sequences Lus10035543|PACid:23147644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]