SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10040689|PACid:23157635 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10040689|PACid:23157635
Domain Number 1 Region: 19-103
Classification Level Classification E-value
Superfamily TSP9-like 3.4e-20
Family TSP9-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10040689|PACid:23157635
Sequence length 103
Sequence
MASLPISFTTAARVFAATAAKGSGGSKEEKGPWDWIVGTLIKEDQFYETDPILNKTEEKS
GGGPTSGRGTTSGRGTTSGRKGTTTVSVPQKKKGGFGGLFAKN
Download sequence
Identical sequences Lus10040689|PACid:23157635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]