SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10000747|PACid:23166264 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10000747|PACid:23166264
Domain Number 1 Region: 135-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 264-350
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000128
Family B3 DNA binding domain 0.0049
Further Details:      
 
Weak hits

Sequence:  Lus10000747|PACid:23166264
Domain Number - Region: 53-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0255
Family B3 DNA binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lus10000747|PACid:23166264
Sequence length 365
Sequence
MEKQQLPETPSFVKIFHGGFAKELVSGNQTLNFPLPPYKTHFPTLFFNPPSFFLQKIPDP
FLNQHGQILSSESSDPRNGNPVVVSVERKIRDECFFTLGWAHFVEETGIIMHIHVFNFSK
DLVVIKKEETMEIHEHPSFVKVFHGGLAKELKIPDPFVSQHSQIIPKKLALMTRKGNPVV
VSVERRSKGQCFFTLGWTHFVEENNLEEGDIIFFYFHGDRTLNVVVYDLLGCLKGVKLTG
HRSAEPRTVAKRVKRAATAANEKLFEFKTFFKSYQKYYQYMPLEFAETVGLKAGGNALFK
DPKGKIWIIGVTDGDTTGRQKRFGSSWNEFVRKNGIEDGDKLSFSFKPSLGFIEVKISKG
VILID
Download sequence
Identical sequences Lus10000747|PACid:23166264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]