SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10003111|PACid:23165942 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10003111|PACid:23165942
Domain Number 1 Region: 358-497
Classification Level Classification E-value
Superfamily CBS-domain pair 8.72e-33
Family CBS-domain pair 0.0028
Further Details:      
 
Domain Number 2 Region: 513-621
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000464
Family CorC/HlyC domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Lus10003111|PACid:23165942
Sequence length 683
Sequence
MEIAFESSFLGRPVSVSGSKFSSLLRYSQVAKLPCKVSSKNYHYRARLSSKFVNPCCSGA
AELNNWSVQRTRVFGSIIASSSLLGNHATGESVSGCNVTSDANWELIIVLLKRGVVLGAL
VCGILMFGYQRVLAAEGVSNPGYGVSGQNILLLKNSWPRLQQLLTVFKEQGLILAALLGL
SAFFSMAETSITTLWPWKVRELAEKDSEDGVFKLLRKDVTRFLTTILIGTTVVNIAATAL
VTEAATTIFGEAGVSAATGVMTVAILLLTEITPKSIAVHNATEVAKFVVRPVAWLSLVLY
PVGRVVTYLSMGMLKILGVKLILAVSPLLCEPYVTEDELKLMLRGAELSGAIEEEEQDMI
ENVLEIKDTHVREVMTPLVDVFAIDAGATLIDFHELWVTHQYSRVPVFEQRVDNIVGIAY
AMDLLDYVQKGELLESTVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT
VGLVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVRRAEGVYDVDANISTDQLSEDLNIK
MPEGHQYETVSGFICEAFGYIPRTGESIKVVLEKETEEDEDAQGISNREQHEKHMIYKLE
VLAGNARKVSAVRFERIQNGDEAVAAKEVTRLLPKFRKRKRRSDKESDGDDDYEDDSFQE
RPVYALSDSNVIAEDDDVDPSRN
Download sequence
Identical sequences Lus10003111|PACid:23165942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]