SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10003812|PACid:23145950 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10003812|PACid:23145950
Domain Number 1 Region: 849-1099
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000392
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 585-757
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000349
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 3 Region: 390-617
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000828
Family Tropomyosin 0.00067
Further Details:      
 
Domain Number 4 Region: 81-275
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000425
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10003812|PACid:23145950
Sequence length 1282
Sequence
MEQETQVSSEVPVVKVLEADSKADIFEVTNGDFPQEHKPEKREEDETDGEFIKIERESLD
VKDGSHAPVAAPSEDDNPSVSEKSASSLTRESLEAEEKIKELKLELERVAEALKQSESEN
AAVKNEALLASEKLEGSETKYKELELDHKKLQEQVDEAEERYASQLKSLQEALEAQELKH
KELVEVKEAFDSLNLDLDSSRKRIEELESGLQQSIDDAKKFEELHKQSGSDAESHSQRAS
EFEKLLEAAKLSAKEMENQMGILKGEVTGLYAKISENQKVEEALQNTTSELSKVQEDFAL
SKSQLLDLEQSLSSKEAVLSKLTEEMELTKVSGSKLKEDFSALENALALTKEDAQAKASE
LESIKLKFQEEIDARQTIESGLKDQEAQVSALQEDLSKIIKEKEDLESTVADLTGDAAQA
KQLCSDLEEKLKLSAENFSKTDSLLSESLANNAELEQKLKSLEEHHTEAGVVAATATQKS
LELEDLIKASNEAASEAQSQLRELETRLIASEQKNLELDQQLNLIQLKNRDAEREIGELS
DKVSELSSGLRGAEEEKKILAGQIQEYQEKVIHLETESSSRHLELEDKLKKATEKHVEIE
NRATETHERSLELENLIHSSRSKSEDAEKKVGELELLLEAEKYRIQELEEQINTLEKKCV
EAEGDSDKYKLKVSELASELEAFQMKASSLEIAVQMATDKEKELTESLNLAAEEKKRLED
ASSSANEKLSEAENLVEVLRNEITVTQEKLQSIESDLTTAGLKESDIMTKLKDAEEKLAQ
QEVMFGEVSARKTELESLTESLSRDSELKLQEAIASFSDKDSEVKSLFEKLQKLEEQVKA
YQTQLAEVTEKSTSLKEELDSSFMKVTSFETENEELNRKILDAESKVSNASSDNQQLIET
NTELQIKVEELNQLLESALSEKDNASQQLASHTTAIAEITDKHSRAIELHSASETNYQEA
VQRLCEKESEVNKLNEKLNSLEVQVKVHEEQASEAQGSSKATKIQLEEALQKLQHLEAVI
EELQAKSGHFEKESGGLAEANLKLTEELASYESKLSDLQSKLSAALSEKDGAVEQLNSSK
KTVEDLTQQLSAEAEKLQSQISKVMEENSQLNEVHQSTKNELQTIIVQLTEQLKEQKEKE
DASKLSLQTRLKELEEQKGTSSDKERETEATVKKALESLEAKNKEVANLEKQVKDLQLAT
AKSVEKDGAEIKSRDIGASLPTTPSKRKNKKKLEAQASSASAETTLTRTASTEGPAGALN
IKLILGVAIVSIVMGIVLGKIY
Download sequence
Identical sequences Lus10003812|PACid:23145950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]