SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10004777|PACid:23140500 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10004777|PACid:23140500
Domain Number 1 Region: 347-486
Classification Level Classification E-value
Superfamily CBS-domain pair 1.52e-32
Family CBS-domain pair 0.0028
Further Details:      
 
Domain Number 2 Region: 502-610
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000464
Family CorC/HlyC domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10004777|PACid:23140500
Sequence length 672
Sequence
MEIAFESSFLGRPVSVSGSKFSSLLRYSQVSKLPCKVSSKNYRLSSKFVNPCCCGAAALN
NWNVQRTRVFGSIIASSSLLGNHATGDSVSGCNVTSDVNSELIIVLLKRGVVLGAMVCGI
LMFGYQRVLAAEGVSNPGYGVSGQNILLLKNSWPRLQQLLTVFKEQGLILAALLGLSAFF
SMAETSITTLWPWKVRELAEKDSEDGVFKLLRKDVTRFLTTILIGTTVVNIAATALVTEA
ATTIFGEAGVSAATGVMTVAILLLTEITPKSIAVHNATEVAKFVVRPVAWLSLVLYPVGR
VVTYLSMGMLKILGLKGISEPYVTEDELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHV
REVMTPLVDVFAIDVGATLIDFHELWVTHQYSRVPVFEQRVDNIVGIAYAMDLLDYVQKG
ELLESTIVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGLVTLEDVVE
EIVGEIFDENDSKEEIQKKTGYIVRRAEGVYDVDANISTDQLSEDLNIKMPEGHQYETVS
GFICEAFGYIPRTGESIKVVLEKETEEDEDAQGISNREQHEKHMIYKLEVLAGNARKVSA
VRFERIQNGDEAVAAKEVTRLLPKFRKRKWRSDKESDGDDHYEDDSFQERPVYALSDSNV
IAEDDDEDPSRN
Download sequence
Identical sequences Lus10004777|PACid:23140500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]