SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lus10006483|PACid:23142513 from Linum usitatissimum v200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lus10006483|PACid:23142513
Domain Number 1 Region: 124-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-18
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Lus10006483|PACid:23142513
Sequence length 241
Sequence
MVAKAKQSNYEELRLNRLEENKKRMEALNLPMLSQSLRTTSPTPSPMKQSKPRPRVVEKQ
IVVVRRSSRVANKPSPVYAEVIVERVVIPRRVSSKTRDLSNRVYASDEARAEALEKAENL
QSSLESHYPSFVKSMLISHVSGGFWLAFCVDDPQGLPVWFCKPNLPKRDEVMTLIDEEGD
EYPTIYLPRKTGLSGGWKGFAVAHNLADGDALIFQLITSTSFKVYITRAKGSQEVSDNNN
I
Download sequence
Identical sequences Lus10006483|PACid:23142513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]